Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SGU2

Protein Details
Accession A0A4Y7SGU2    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
117-145ASKAVKANKEKQKKAKRDKRADERRMTGRBasic
298-323LKELENDKKEKKPKKPTNPGPTFDCNHydrophilic
NLS Segment(s)
PositionSequence
117-142ASKAVKANKEKQKKAKRDKRADERRM
305-313KKEKKPKKP
Subcellular Location(s) cyto 16.5, cyto_nucl 14.333, nucl 9, mito_nucl 5.499
Family & Domain DBs
Amino Acid Sequences MSYYIPTDPELEAQEKARTVGHAESCWSLADFWTGIEYLSSSAPYSSYVSAESVEDKENISPPTPAVTSYSIDYSGKCVDAVPPPAIATPVRASDEAIAPFLDLVENAPTIFTGKAASKAVKANKEKQKKAKRDKRADERRMTGRVLAKIPSPIISLRLKGDEPKYEAMLRNPLADPTEAHTVETPKWLGESYNPATAGMGKDEVIKNAALVKKAHKLGDVYSDVKGILIPIEGVRYHRDVCPMKDVKPKGCDERFTKFSKANFHGPAYYGAYFEELEGTDEPLVQDKEIPKPVKNILKELENDKKEKKPKKPTNPGPTFDCNGVPTYQVSTPFAFRHVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.24
4 0.23
5 0.2
6 0.21
7 0.25
8 0.27
9 0.24
10 0.26
11 0.26
12 0.26
13 0.25
14 0.23
15 0.16
16 0.13
17 0.14
18 0.12
19 0.1
20 0.11
21 0.1
22 0.09
23 0.09
24 0.09
25 0.08
26 0.09
27 0.09
28 0.08
29 0.08
30 0.09
31 0.1
32 0.12
33 0.12
34 0.12
35 0.13
36 0.13
37 0.13
38 0.14
39 0.15
40 0.14
41 0.15
42 0.15
43 0.15
44 0.16
45 0.19
46 0.2
47 0.18
48 0.17
49 0.16
50 0.19
51 0.18
52 0.17
53 0.17
54 0.18
55 0.18
56 0.18
57 0.19
58 0.17
59 0.18
60 0.17
61 0.17
62 0.16
63 0.15
64 0.13
65 0.12
66 0.14
67 0.18
68 0.21
69 0.19
70 0.18
71 0.18
72 0.18
73 0.19
74 0.16
75 0.14
76 0.13
77 0.14
78 0.16
79 0.15
80 0.16
81 0.16
82 0.19
83 0.17
84 0.16
85 0.13
86 0.11
87 0.11
88 0.1
89 0.08
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.06
100 0.07
101 0.08
102 0.11
103 0.13
104 0.14
105 0.15
106 0.21
107 0.27
108 0.34
109 0.38
110 0.45
111 0.53
112 0.62
113 0.67
114 0.72
115 0.77
116 0.8
117 0.86
118 0.86
119 0.87
120 0.88
121 0.91
122 0.91
123 0.92
124 0.9
125 0.85
126 0.81
127 0.76
128 0.68
129 0.58
130 0.52
131 0.45
132 0.39
133 0.34
134 0.28
135 0.24
136 0.22
137 0.22
138 0.18
139 0.15
140 0.12
141 0.14
142 0.14
143 0.14
144 0.14
145 0.16
146 0.15
147 0.18
148 0.2
149 0.19
150 0.21
151 0.21
152 0.21
153 0.22
154 0.23
155 0.2
156 0.23
157 0.2
158 0.19
159 0.18
160 0.17
161 0.16
162 0.15
163 0.14
164 0.12
165 0.17
166 0.15
167 0.15
168 0.15
169 0.16
170 0.16
171 0.18
172 0.15
173 0.09
174 0.1
175 0.1
176 0.09
177 0.09
178 0.16
179 0.16
180 0.18
181 0.18
182 0.18
183 0.18
184 0.18
185 0.17
186 0.11
187 0.09
188 0.07
189 0.1
190 0.11
191 0.11
192 0.11
193 0.11
194 0.1
195 0.14
196 0.16
197 0.14
198 0.15
199 0.19
200 0.24
201 0.27
202 0.27
203 0.24
204 0.24
205 0.23
206 0.28
207 0.29
208 0.24
209 0.21
210 0.21
211 0.19
212 0.18
213 0.16
214 0.1
215 0.06
216 0.05
217 0.05
218 0.05
219 0.06
220 0.07
221 0.08
222 0.11
223 0.13
224 0.15
225 0.16
226 0.24
227 0.26
228 0.28
229 0.36
230 0.36
231 0.4
232 0.47
233 0.5
234 0.48
235 0.51
236 0.53
237 0.52
238 0.54
239 0.55
240 0.52
241 0.56
242 0.54
243 0.53
244 0.53
245 0.48
246 0.47
247 0.5
248 0.5
249 0.49
250 0.48
251 0.46
252 0.43
253 0.4
254 0.39
255 0.34
256 0.3
257 0.22
258 0.18
259 0.17
260 0.16
261 0.14
262 0.12
263 0.08
264 0.1
265 0.1
266 0.12
267 0.1
268 0.11
269 0.11
270 0.14
271 0.14
272 0.12
273 0.16
274 0.17
275 0.24
276 0.32
277 0.35
278 0.33
279 0.38
280 0.46
281 0.5
282 0.5
283 0.5
284 0.46
285 0.48
286 0.5
287 0.53
288 0.55
289 0.51
290 0.54
291 0.54
292 0.59
293 0.63
294 0.7
295 0.72
296 0.73
297 0.79
298 0.85
299 0.91
300 0.93
301 0.94
302 0.93
303 0.87
304 0.83
305 0.79
306 0.7
307 0.61
308 0.52
309 0.43
310 0.36
311 0.32
312 0.26
313 0.2
314 0.21
315 0.22
316 0.22
317 0.24
318 0.24
319 0.27
320 0.27
321 0.28