Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SQ37

Protein Details
Accession A0A4Y7SQ37   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-46LCKIKKADTDKCKKCNRGRRETVQHFHydrophilic
NLS Segment(s)
PositionSequence
62-69RAHKKAKR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences RDQSSYLTQIRTGRLPLNDHLCKIKKADTDKCKKCNRGRRETVQHFLFECQEYKTLRSKMDRAHKKAKRNLKMILRSEQHTKILLRYVVNTRRFTNGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.36
4 0.41
5 0.4
6 0.39
7 0.45
8 0.43
9 0.41
10 0.4
11 0.4
12 0.37
13 0.42
14 0.5
15 0.53
16 0.61
17 0.67
18 0.74
19 0.76
20 0.8
21 0.81
22 0.82
23 0.81
24 0.81
25 0.8
26 0.81
27 0.83
28 0.8
29 0.77
30 0.69
31 0.6
32 0.5
33 0.43
34 0.34
35 0.25
36 0.19
37 0.13
38 0.15
39 0.14
40 0.16
41 0.21
42 0.22
43 0.25
44 0.28
45 0.31
46 0.36
47 0.46
48 0.53
49 0.54
50 0.62
51 0.65
52 0.71
53 0.76
54 0.79
55 0.77
56 0.73
57 0.74
58 0.73
59 0.76
60 0.71
61 0.71
62 0.64
63 0.58
64 0.59
65 0.54
66 0.47
67 0.41
68 0.37
69 0.31
70 0.34
71 0.33
72 0.28
73 0.3
74 0.37
75 0.42
76 0.48
77 0.49
78 0.45