Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SAH6

Protein Details
Accession A0A4Y7SAH6    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-37APATQRCRSTCRRDRNCAYRHSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MTDNRCWEEGYPSCEAPATQRCRSTCRRDRNCAYRHSPPMDSKLPRNSAPGLSRGPREAVRIFEPPCCVGKSIHNFVATQDPMRALTFPQAPSDGTAGQHDIRPTGKGLEILSLLRFFRLVSHTFDYEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.26
4 0.3
5 0.33
6 0.34
7 0.4
8 0.42
9 0.48
10 0.57
11 0.61
12 0.62
13 0.66
14 0.71
15 0.74
16 0.82
17 0.84
18 0.82
19 0.79
20 0.76
21 0.74
22 0.72
23 0.66
24 0.61
25 0.55
26 0.55
27 0.54
28 0.51
29 0.48
30 0.48
31 0.47
32 0.44
33 0.44
34 0.39
35 0.36
36 0.34
37 0.32
38 0.28
39 0.27
40 0.27
41 0.24
42 0.25
43 0.21
44 0.23
45 0.2
46 0.19
47 0.2
48 0.23
49 0.23
50 0.22
51 0.22
52 0.2
53 0.21
54 0.19
55 0.17
56 0.14
57 0.19
58 0.24
59 0.27
60 0.29
61 0.28
62 0.27
63 0.27
64 0.33
65 0.26
66 0.21
67 0.17
68 0.15
69 0.15
70 0.15
71 0.15
72 0.09
73 0.13
74 0.16
75 0.16
76 0.16
77 0.16
78 0.16
79 0.17
80 0.19
81 0.15
82 0.12
83 0.13
84 0.14
85 0.14
86 0.16
87 0.15
88 0.15
89 0.15
90 0.16
91 0.16
92 0.15
93 0.16
94 0.15
95 0.16
96 0.16
97 0.16
98 0.16
99 0.16
100 0.17
101 0.16
102 0.14
103 0.14
104 0.11
105 0.13
106 0.17
107 0.18
108 0.22
109 0.27
110 0.29