Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7TNU3

Protein Details
Accession A0A4Y7TNU3    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-56EHLRKEPFEKKCFRRKDLADBasic
387-416EPSPTRSPQLTPKHRRKAKSRNPRGLSGSFHydrophilic
NLS Segment(s)
PositionSequence
392-410RSPQLTPKHRRKAKSRNPR
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MASFDSQQLPAVHYCRFDWCLSSFSTPSDYIRHAFLEHLRKEPFEKKCFRRKDLADIERAEEGIGESMSIPMPGRMIASSHDNIVKEDSAQSTFQQVPSSLPTPPVSEAASPPAHIHPILALPQDAGVDPNLLSAPSPTPAQLFSADDGQYRIKTPSFRDLSSRNDAIHPRKRQRLDLNPSDLSRRNPSLDSATSNADCYAVEQHLTQSLEDAMEDGELQLSDLIHQERLDDIENPVMEQSVPYTDASASIRMPVILPPQSQPFFTQGSDLYAGEIFQSHVPLSDSPELEPAPTFQPAEVAHSTSNQSTNQTESSQESENSSTSKSSNVSMPPPAQPPRRTIQSQLKSSSQDPDPFFFPSSGASARKPFYPQAEVAAPERQAALKKEPSPTRSPQLTPKHRRKAKSRNPRGLSGSFDLMAAPQARQKLGSPFNSTGLQNPRSGWEYQTQDESLPPIMTQAPYGSQDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.31
4 0.29
5 0.28
6 0.27
7 0.28
8 0.29
9 0.32
10 0.27
11 0.26
12 0.29
13 0.27
14 0.27
15 0.28
16 0.28
17 0.25
18 0.26
19 0.26
20 0.22
21 0.25
22 0.3
23 0.36
24 0.36
25 0.41
26 0.4
27 0.41
28 0.46
29 0.51
30 0.53
31 0.52
32 0.6
33 0.63
34 0.71
35 0.79
36 0.79
37 0.8
38 0.76
39 0.77
40 0.78
41 0.75
42 0.72
43 0.65
44 0.62
45 0.52
46 0.47
47 0.36
48 0.25
49 0.19
50 0.13
51 0.1
52 0.07
53 0.07
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.09
64 0.1
65 0.16
66 0.17
67 0.19
68 0.22
69 0.21
70 0.22
71 0.24
72 0.22
73 0.17
74 0.19
75 0.18
76 0.17
77 0.18
78 0.17
79 0.19
80 0.21
81 0.21
82 0.2
83 0.19
84 0.18
85 0.22
86 0.24
87 0.19
88 0.21
89 0.21
90 0.21
91 0.22
92 0.22
93 0.18
94 0.18
95 0.18
96 0.21
97 0.2
98 0.18
99 0.19
100 0.19
101 0.19
102 0.17
103 0.16
104 0.11
105 0.13
106 0.15
107 0.13
108 0.12
109 0.11
110 0.11
111 0.11
112 0.1
113 0.09
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.07
122 0.08
123 0.08
124 0.09
125 0.09
126 0.09
127 0.1
128 0.12
129 0.12
130 0.12
131 0.12
132 0.15
133 0.15
134 0.15
135 0.16
136 0.16
137 0.16
138 0.16
139 0.17
140 0.15
141 0.18
142 0.21
143 0.29
144 0.31
145 0.31
146 0.34
147 0.36
148 0.4
149 0.43
150 0.42
151 0.33
152 0.34
153 0.39
154 0.43
155 0.49
156 0.52
157 0.53
158 0.6
159 0.62
160 0.66
161 0.68
162 0.7
163 0.7
164 0.68
165 0.67
166 0.6
167 0.58
168 0.55
169 0.49
170 0.41
171 0.37
172 0.32
173 0.28
174 0.26
175 0.27
176 0.27
177 0.25
178 0.25
179 0.21
180 0.22
181 0.2
182 0.19
183 0.17
184 0.13
185 0.11
186 0.1
187 0.1
188 0.08
189 0.08
190 0.08
191 0.08
192 0.11
193 0.12
194 0.11
195 0.09
196 0.09
197 0.09
198 0.08
199 0.08
200 0.05
201 0.04
202 0.04
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.04
210 0.05
211 0.06
212 0.07
213 0.07
214 0.07
215 0.07
216 0.08
217 0.09
218 0.08
219 0.08
220 0.09
221 0.09
222 0.09
223 0.09
224 0.08
225 0.07
226 0.06
227 0.06
228 0.04
229 0.06
230 0.06
231 0.06
232 0.06
233 0.08
234 0.09
235 0.09
236 0.09
237 0.08
238 0.08
239 0.08
240 0.08
241 0.08
242 0.11
243 0.12
244 0.13
245 0.13
246 0.18
247 0.19
248 0.19
249 0.19
250 0.18
251 0.18
252 0.17
253 0.17
254 0.13
255 0.14
256 0.15
257 0.14
258 0.11
259 0.09
260 0.09
261 0.08
262 0.08
263 0.06
264 0.05
265 0.06
266 0.06
267 0.06
268 0.08
269 0.08
270 0.12
271 0.15
272 0.15
273 0.15
274 0.17
275 0.16
276 0.15
277 0.15
278 0.13
279 0.11
280 0.12
281 0.11
282 0.09
283 0.12
284 0.12
285 0.17
286 0.16
287 0.16
288 0.15
289 0.16
290 0.18
291 0.16
292 0.19
293 0.14
294 0.16
295 0.15
296 0.17
297 0.18
298 0.17
299 0.17
300 0.17
301 0.19
302 0.19
303 0.19
304 0.18
305 0.18
306 0.18
307 0.17
308 0.16
309 0.14
310 0.13
311 0.14
312 0.13
313 0.14
314 0.17
315 0.19
316 0.21
317 0.24
318 0.26
319 0.27
320 0.32
321 0.38
322 0.41
323 0.41
324 0.43
325 0.45
326 0.49
327 0.48
328 0.5
329 0.54
330 0.55
331 0.59
332 0.58
333 0.56
334 0.52
335 0.52
336 0.49
337 0.43
338 0.41
339 0.37
340 0.35
341 0.34
342 0.32
343 0.32
344 0.27
345 0.23
346 0.17
347 0.18
348 0.19
349 0.19
350 0.2
351 0.23
352 0.24
353 0.26
354 0.29
355 0.3
356 0.31
357 0.33
358 0.31
359 0.31
360 0.33
361 0.32
362 0.31
363 0.31
364 0.26
365 0.22
366 0.22
367 0.19
368 0.2
369 0.22
370 0.27
371 0.31
372 0.35
373 0.43
374 0.49
375 0.53
376 0.56
377 0.58
378 0.6
379 0.58
380 0.58
381 0.59
382 0.63
383 0.69
384 0.73
385 0.77
386 0.8
387 0.82
388 0.86
389 0.87
390 0.88
391 0.88
392 0.88
393 0.89
394 0.89
395 0.86
396 0.85
397 0.81
398 0.72
399 0.68
400 0.6
401 0.52
402 0.41
403 0.35
404 0.28
405 0.21
406 0.22
407 0.17
408 0.14
409 0.14
410 0.17
411 0.17
412 0.19
413 0.22
414 0.27
415 0.34
416 0.39
417 0.43
418 0.42
419 0.45
420 0.47
421 0.45
422 0.43
423 0.44
424 0.41
425 0.36
426 0.35
427 0.36
428 0.35
429 0.36
430 0.32
431 0.31
432 0.34
433 0.35
434 0.39
435 0.35
436 0.33
437 0.33
438 0.32
439 0.26
440 0.21
441 0.18
442 0.16
443 0.17
444 0.17
445 0.17
446 0.17
447 0.17