Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TZ84

Protein Details
Accession A0A4Y7TZ84   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-24GEPPLSRRCGDKRRWWRLWLSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, vacu 3, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007274  Cop_transporter  
Gene Ontology GO:0016020  C:membrane  
GO:0005375  F:copper ion transmembrane transporter activity  
GO:0006878  P:intracellular copper ion homeostasis  
Pfam View protein in Pfam  
PF04145  Ctr  
Amino Acid Sequences MSEGEPPLSRRCGDKRRWWRLWLSPVAMNLAIWGPEASTHGPALPAAVLLVQAPLDISNSDTYTIKQIDLADHDTSSTSTSTASSGHDMMTPYLHFNGGDYLYFSAWQPNSPGAIVGACVGLFMLALFERWFGSLRAVFEHHWKHRALLLSSKFSARSEGTELLATGSRTDKSTSTGTQEKELEASVVSVPPLVPRLRIRTIPPFVPSQDIPRGIMYAFHMFVGYLLMLAVMLVLFALFLSIHPAHSLADRTFHAGYIISIVVGLGVGEVAFGRTTCNLAALSVMGPLVCLLFGWFLSVRKPTVRISERVPTVAPAPPCSLCRSRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.77
4 0.83
5 0.82
6 0.8
7 0.79
8 0.79
9 0.75
10 0.68
11 0.61
12 0.55
13 0.52
14 0.44
15 0.34
16 0.25
17 0.19
18 0.14
19 0.11
20 0.1
21 0.07
22 0.07
23 0.11
24 0.11
25 0.12
26 0.12
27 0.12
28 0.12
29 0.12
30 0.12
31 0.1
32 0.08
33 0.06
34 0.06
35 0.06
36 0.05
37 0.06
38 0.05
39 0.04
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.09
46 0.09
47 0.11
48 0.12
49 0.12
50 0.17
51 0.18
52 0.16
53 0.16
54 0.17
55 0.17
56 0.21
57 0.24
58 0.19
59 0.18
60 0.18
61 0.17
62 0.16
63 0.16
64 0.12
65 0.08
66 0.08
67 0.08
68 0.09
69 0.09
70 0.1
71 0.11
72 0.11
73 0.12
74 0.13
75 0.13
76 0.13
77 0.14
78 0.13
79 0.12
80 0.12
81 0.12
82 0.1
83 0.09
84 0.11
85 0.1
86 0.1
87 0.09
88 0.1
89 0.09
90 0.1
91 0.1
92 0.12
93 0.12
94 0.13
95 0.13
96 0.13
97 0.14
98 0.13
99 0.13
100 0.08
101 0.08
102 0.08
103 0.07
104 0.05
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.05
118 0.06
119 0.06
120 0.09
121 0.1
122 0.11
123 0.12
124 0.14
125 0.14
126 0.2
127 0.26
128 0.27
129 0.29
130 0.28
131 0.27
132 0.29
133 0.32
134 0.27
135 0.27
136 0.28
137 0.28
138 0.28
139 0.28
140 0.26
141 0.22
142 0.23
143 0.16
144 0.15
145 0.15
146 0.15
147 0.15
148 0.14
149 0.14
150 0.12
151 0.13
152 0.11
153 0.08
154 0.08
155 0.08
156 0.09
157 0.1
158 0.09
159 0.12
160 0.14
161 0.15
162 0.18
163 0.23
164 0.23
165 0.25
166 0.25
167 0.22
168 0.2
169 0.19
170 0.15
171 0.1
172 0.1
173 0.07
174 0.06
175 0.06
176 0.05
177 0.05
178 0.05
179 0.09
180 0.08
181 0.11
182 0.13
183 0.2
184 0.22
185 0.25
186 0.29
187 0.34
188 0.38
189 0.37
190 0.36
191 0.32
192 0.3
193 0.32
194 0.28
195 0.25
196 0.26
197 0.25
198 0.24
199 0.22
200 0.22
201 0.18
202 0.18
203 0.16
204 0.13
205 0.13
206 0.11
207 0.11
208 0.1
209 0.1
210 0.1
211 0.07
212 0.04
213 0.04
214 0.03
215 0.03
216 0.03
217 0.03
218 0.02
219 0.02
220 0.02
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.02
227 0.08
228 0.08
229 0.09
230 0.09
231 0.1
232 0.1
233 0.12
234 0.16
235 0.11
236 0.14
237 0.15
238 0.18
239 0.18
240 0.18
241 0.17
242 0.14
243 0.13
244 0.12
245 0.12
246 0.07
247 0.07
248 0.06
249 0.06
250 0.05
251 0.05
252 0.02
253 0.02
254 0.02
255 0.02
256 0.03
257 0.03
258 0.04
259 0.04
260 0.05
261 0.06
262 0.08
263 0.08
264 0.1
265 0.09
266 0.09
267 0.1
268 0.09
269 0.09
270 0.08
271 0.08
272 0.06
273 0.06
274 0.06
275 0.05
276 0.04
277 0.04
278 0.04
279 0.05
280 0.05
281 0.08
282 0.1
283 0.11
284 0.14
285 0.18
286 0.2
287 0.22
288 0.26
289 0.27
290 0.36
291 0.41
292 0.42
293 0.45
294 0.51
295 0.51
296 0.5
297 0.47
298 0.38
299 0.35
300 0.37
301 0.33
302 0.28
303 0.29
304 0.29
305 0.31
306 0.35