Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SE56

Protein Details
Accession A0A4Y7SE56    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
281-300MPYAERRRAGKHTRRVIVRTHydrophilic
NLS Segment(s)
PositionSequence
287-292RRAGKH
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MSGFSLRPVHDMSPSPSPTASTTSPDDHPAYKVPAPVPSRPSPPTTANGRPRRPFSPSSLRDLDLSQSNDGQPRKYPAPPTGHDLMAMFPPAPPDNFPEMRPGPTSGFFQRQERAFFAQAGKEIVRVRLEVDLPHGPGSDSSEAGKSSSLSRASSSSSRPWPPAASSSSHGPPPVSGSTSHSPSISSSTAPPPYPHPASHRTSPRGSLSNAAAHFPISPGHSHPHPHSQGPPPNLHPPPGQMHQHGPGVRTPPQDPSQLASGAKPEYPQEDYDDESWKRPMPYAERRRAGKHTRRVIVRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.32
4 0.32
5 0.3
6 0.32
7 0.29
8 0.25
9 0.27
10 0.29
11 0.31
12 0.34
13 0.34
14 0.31
15 0.31
16 0.31
17 0.32
18 0.31
19 0.33
20 0.3
21 0.35
22 0.38
23 0.41
24 0.44
25 0.43
26 0.47
27 0.46
28 0.49
29 0.46
30 0.45
31 0.46
32 0.46
33 0.51
34 0.55
35 0.62
36 0.67
37 0.68
38 0.7
39 0.68
40 0.67
41 0.61
42 0.59
43 0.6
44 0.55
45 0.56
46 0.54
47 0.51
48 0.46
49 0.42
50 0.37
51 0.32
52 0.31
53 0.24
54 0.22
55 0.23
56 0.28
57 0.28
58 0.27
59 0.24
60 0.28
61 0.3
62 0.33
63 0.36
64 0.37
65 0.43
66 0.44
67 0.47
68 0.44
69 0.4
70 0.36
71 0.32
72 0.25
73 0.19
74 0.17
75 0.11
76 0.08
77 0.1
78 0.11
79 0.11
80 0.11
81 0.15
82 0.21
83 0.22
84 0.22
85 0.27
86 0.28
87 0.29
88 0.3
89 0.27
90 0.23
91 0.23
92 0.26
93 0.22
94 0.27
95 0.27
96 0.29
97 0.31
98 0.31
99 0.32
100 0.31
101 0.32
102 0.26
103 0.26
104 0.25
105 0.21
106 0.2
107 0.19
108 0.16
109 0.15
110 0.15
111 0.15
112 0.14
113 0.13
114 0.13
115 0.13
116 0.14
117 0.11
118 0.14
119 0.14
120 0.14
121 0.14
122 0.13
123 0.11
124 0.11
125 0.14
126 0.11
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.1
133 0.08
134 0.08
135 0.11
136 0.11
137 0.11
138 0.12
139 0.12
140 0.15
141 0.17
142 0.18
143 0.2
144 0.24
145 0.25
146 0.26
147 0.26
148 0.25
149 0.24
150 0.25
151 0.22
152 0.2
153 0.19
154 0.22
155 0.22
156 0.22
157 0.21
158 0.17
159 0.15
160 0.16
161 0.15
162 0.13
163 0.12
164 0.17
165 0.2
166 0.22
167 0.23
168 0.19
169 0.18
170 0.18
171 0.21
172 0.16
173 0.14
174 0.13
175 0.17
176 0.2
177 0.2
178 0.21
179 0.21
180 0.27
181 0.29
182 0.28
183 0.3
184 0.34
185 0.38
186 0.45
187 0.49
188 0.47
189 0.47
190 0.48
191 0.47
192 0.44
193 0.4
194 0.36
195 0.3
196 0.3
197 0.29
198 0.26
199 0.22
200 0.18
201 0.18
202 0.14
203 0.13
204 0.09
205 0.1
206 0.12
207 0.16
208 0.17
209 0.21
210 0.24
211 0.33
212 0.35
213 0.36
214 0.4
215 0.45
216 0.5
217 0.51
218 0.53
219 0.47
220 0.54
221 0.52
222 0.5
223 0.42
224 0.39
225 0.4
226 0.41
227 0.41
228 0.35
229 0.38
230 0.39
231 0.43
232 0.4
233 0.36
234 0.33
235 0.34
236 0.36
237 0.36
238 0.33
239 0.34
240 0.36
241 0.38
242 0.36
243 0.34
244 0.32
245 0.32
246 0.31
247 0.25
248 0.25
249 0.23
250 0.22
251 0.2
252 0.19
253 0.2
254 0.22
255 0.23
256 0.24
257 0.24
258 0.27
259 0.28
260 0.33
261 0.31
262 0.31
263 0.33
264 0.32
265 0.31
266 0.31
267 0.36
268 0.38
269 0.48
270 0.56
271 0.63
272 0.68
273 0.72
274 0.75
275 0.77
276 0.79
277 0.78
278 0.77
279 0.77
280 0.78