Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7THC4

Protein Details
Accession A0A4Y7THC4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-36VVPKHRMGREKMRERRRDSCSBasic
NLS Segment(s)
PositionSequence
23-30GREKMRER
Subcellular Location(s) mito 13.5, cyto_mito 9.5, nucl 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MERVRAFTLPGRSIVVVPKHRMGREKMRERRRDSCSIERNMKGRIQRRFPLSTYPFFALPSRANAPSSPGSSRNVSWEVGPIRSFMLTTSRGLLDAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.33
4 0.35
5 0.4
6 0.42
7 0.44
8 0.49
9 0.49
10 0.52
11 0.57
12 0.64
13 0.67
14 0.73
15 0.79
16 0.81
17 0.83
18 0.79
19 0.77
20 0.73
21 0.73
22 0.71
23 0.69
24 0.68
25 0.63
26 0.58
27 0.52
28 0.48
29 0.45
30 0.44
31 0.44
32 0.44
33 0.45
34 0.48
35 0.48
36 0.46
37 0.48
38 0.45
39 0.4
40 0.36
41 0.33
42 0.28
43 0.26
44 0.25
45 0.19
46 0.16
47 0.18
48 0.18
49 0.18
50 0.19
51 0.18
52 0.22
53 0.22
54 0.24
55 0.22
56 0.21
57 0.23
58 0.25
59 0.26
60 0.26
61 0.25
62 0.23
63 0.21
64 0.25
65 0.24
66 0.24
67 0.24
68 0.2
69 0.19
70 0.18
71 0.18
72 0.12
73 0.16
74 0.15
75 0.16
76 0.18
77 0.18
78 0.18