Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TDK5

Protein Details
Accession A0A4Y7TDK5    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-81FHLARSFPSKRRNRRTTCGRPMKTFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 11, cyto 6.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MSTGTNDPPSVRLGTVSLDLLHQYGWVSRWYVERDSFTAEVNTPRTTFPGVRPGVFHLARSFPSKRRNRRTTCGRPMKTFERRPHGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.12
5 0.11
6 0.11
7 0.11
8 0.09
9 0.08
10 0.07
11 0.07
12 0.08
13 0.08
14 0.09
15 0.1
16 0.14
17 0.17
18 0.2
19 0.21
20 0.22
21 0.22
22 0.25
23 0.24
24 0.21
25 0.18
26 0.16
27 0.17
28 0.17
29 0.17
30 0.13
31 0.13
32 0.13
33 0.15
34 0.15
35 0.15
36 0.21
37 0.22
38 0.21
39 0.22
40 0.24
41 0.29
42 0.28
43 0.27
44 0.2
45 0.21
46 0.22
47 0.27
48 0.28
49 0.28
50 0.38
51 0.47
52 0.56
53 0.65
54 0.74
55 0.77
56 0.83
57 0.87
58 0.88
59 0.89
60 0.9
61 0.85
62 0.81
63 0.8
64 0.8
65 0.79
66 0.78
67 0.76