Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SVR8

Protein Details
Accession A0A4Y7SVR8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MKLQQRRIRSTYKNKDKKKRYQSNNDTMSYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 13.5, mito 6
Family & Domain DBs
Amino Acid Sequences MKLQQRRIRSTYKNKDKKKRYQSNNDTMSYEYVSVEYNPRDGLPLSVGAERNYTVQRVQMGCEVRWVMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.91
3 0.92
4 0.92
5 0.92
6 0.91
7 0.9
8 0.91
9 0.91
10 0.9
11 0.86
12 0.77
13 0.66
14 0.57
15 0.47
16 0.37
17 0.27
18 0.17
19 0.11
20 0.09
21 0.09
22 0.1
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.09
29 0.09
30 0.08
31 0.09
32 0.1
33 0.13
34 0.14
35 0.13
36 0.14
37 0.14
38 0.16
39 0.16
40 0.16
41 0.14
42 0.15
43 0.2
44 0.2
45 0.21
46 0.25
47 0.27
48 0.26
49 0.31