Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T1F9

Protein Details
Accession A0A4Y7T1F9    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-99SPGPQRWPWDPVRRKRRTKQSGIFASLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12.333, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MKRVAGRLLKHTFLSICLRGKKLAGFQDVGDPLFCRKVFPARSSFGGEIVKKPHSALSKKGPCRCSRTPSCSPGPQRWPWDPVRRKRRTKQSGIFASLPKPSTTEAPMSDIPLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.34
4 0.36
5 0.37
6 0.36
7 0.37
8 0.36
9 0.36
10 0.36
11 0.33
12 0.3
13 0.28
14 0.33
15 0.32
16 0.3
17 0.24
18 0.18
19 0.16
20 0.19
21 0.18
22 0.13
23 0.14
24 0.22
25 0.25
26 0.29
27 0.32
28 0.31
29 0.33
30 0.36
31 0.35
32 0.29
33 0.29
34 0.26
35 0.24
36 0.24
37 0.23
38 0.19
39 0.19
40 0.2
41 0.22
42 0.24
43 0.27
44 0.34
45 0.41
46 0.47
47 0.53
48 0.54
49 0.52
50 0.58
51 0.59
52 0.57
53 0.56
54 0.59
55 0.59
56 0.6
57 0.62
58 0.61
59 0.61
60 0.6
61 0.59
62 0.56
63 0.56
64 0.53
65 0.53
66 0.53
67 0.59
68 0.6
69 0.64
70 0.7
71 0.74
72 0.8
73 0.85
74 0.88
75 0.88
76 0.89
77 0.87
78 0.87
79 0.85
80 0.81
81 0.75
82 0.66
83 0.58
84 0.52
85 0.45
86 0.35
87 0.28
88 0.24
89 0.23
90 0.24
91 0.26
92 0.23
93 0.27
94 0.28
95 0.29