Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DAK6

Protein Details
Accession A5DAK6    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-108DAYKECKRDFFNKKRQDKREGKKGWGABasic
NLS Segment(s)
PositionSequence
94-105KKRQDKREGKKG
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
KEGG pgu:PGUG_00311  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MEPPKDSDSVEMDKSKVDFTSGGVDKFKFYPDNPENHRHKYRFSMKEPSKYYDPCEETRQASINCMIRNPEDKKTVCQDFFDAYKECKRDFFNKKRQDKREGKKGWGAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.2
4 0.17
5 0.13
6 0.13
7 0.21
8 0.21
9 0.22
10 0.23
11 0.23
12 0.23
13 0.24
14 0.25
15 0.19
16 0.17
17 0.26
18 0.28
19 0.36
20 0.4
21 0.48
22 0.52
23 0.57
24 0.65
25 0.56
26 0.54
27 0.56
28 0.6
29 0.59
30 0.58
31 0.61
32 0.57
33 0.65
34 0.65
35 0.6
36 0.55
37 0.48
38 0.46
39 0.43
40 0.41
41 0.35
42 0.36
43 0.33
44 0.3
45 0.3
46 0.31
47 0.24
48 0.22
49 0.23
50 0.23
51 0.21
52 0.2
53 0.2
54 0.18
55 0.26
56 0.28
57 0.29
58 0.32
59 0.33
60 0.36
61 0.42
62 0.46
63 0.39
64 0.37
65 0.34
66 0.31
67 0.31
68 0.3
69 0.26
70 0.23
71 0.28
72 0.3
73 0.28
74 0.3
75 0.33
76 0.4
77 0.48
78 0.56
79 0.6
80 0.68
81 0.78
82 0.84
83 0.88
84 0.88
85 0.88
86 0.88
87 0.88
88 0.84
89 0.81