Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TUL1

Protein Details
Accession A0A4Y7TUL1    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
120-140EAKSRHPQPLVKRRRKQAYSYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10cyto 10cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR046520  DUF6697  
Pfam View protein in Pfam  
PF20411  DUF6697  
Amino Acid Sequences MGEYEWTAIGTTDVEVFRAQKRKVKEHWADELLRWKISLGDHYPSMRARIALRIAGLLPSGSADRDKKLVKEELERIKSNMGHPANREDIISAFDQGEEAIDITLLRCVSYDRTLALDIEAKSRHPQPLVKRRRKQAYSYPYATKSSRAQACMVLDVRTKRLCPADGSTSYTAPDIHAGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.21
5 0.28
6 0.31
7 0.34
8 0.41
9 0.49
10 0.56
11 0.64
12 0.66
13 0.65
14 0.7
15 0.7
16 0.65
17 0.59
18 0.61
19 0.52
20 0.43
21 0.36
22 0.28
23 0.24
24 0.23
25 0.26
26 0.2
27 0.21
28 0.23
29 0.24
30 0.27
31 0.25
32 0.27
33 0.22
34 0.2
35 0.18
36 0.2
37 0.21
38 0.19
39 0.19
40 0.17
41 0.16
42 0.15
43 0.13
44 0.08
45 0.06
46 0.06
47 0.06
48 0.06
49 0.09
50 0.09
51 0.11
52 0.15
53 0.17
54 0.17
55 0.22
56 0.26
57 0.26
58 0.3
59 0.37
60 0.41
61 0.45
62 0.44
63 0.41
64 0.39
65 0.38
66 0.33
67 0.33
68 0.26
69 0.24
70 0.24
71 0.27
72 0.26
73 0.25
74 0.24
75 0.16
76 0.14
77 0.14
78 0.13
79 0.1
80 0.07
81 0.07
82 0.07
83 0.06
84 0.06
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.05
92 0.05
93 0.04
94 0.04
95 0.05
96 0.08
97 0.1
98 0.1
99 0.1
100 0.11
101 0.12
102 0.12
103 0.12
104 0.14
105 0.13
106 0.16
107 0.16
108 0.16
109 0.18
110 0.21
111 0.23
112 0.21
113 0.27
114 0.34
115 0.44
116 0.55
117 0.62
118 0.68
119 0.75
120 0.82
121 0.82
122 0.79
123 0.78
124 0.77
125 0.75
126 0.72
127 0.68
128 0.61
129 0.6
130 0.54
131 0.48
132 0.42
133 0.42
134 0.41
135 0.37
136 0.36
137 0.35
138 0.36
139 0.37
140 0.34
141 0.27
142 0.28
143 0.28
144 0.32
145 0.31
146 0.3
147 0.3
148 0.33
149 0.33
150 0.32
151 0.36
152 0.38
153 0.38
154 0.44
155 0.42
156 0.38
157 0.36
158 0.33
159 0.27
160 0.2
161 0.23