Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SZQ8

Protein Details
Accession A0A4Y7SZQ8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-117PPTTPTRMSHRRQPKKAKKTRKSRGSEGKGABasic
NLS Segment(s)
PositionSequence
95-115SHRRQPKKAKKTRKSRGSEGK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVFPSYHPASDVEHDSSPSPYPPSTPSFDSDSEDERPNLVSGSLSATLAALPEHRLRDIVMRLAGSDSSFRRALKREVSRAEEPETPPTTPTRMSHRRQPKKAKKTRKSRGSEGKGAPMSPPSVADTPTPEEGHDDQLVYHPGHLEDEVYEFVSRTPNGAASKVVQTVTMWNCCNEDEWSPGCILIAPAFDRDPGRLALLDMRSCLRKDPDVYPDDSDLESPYTSDLLTPVSPVRGQSMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.27
4 0.25
5 0.23
6 0.22
7 0.18
8 0.2
9 0.23
10 0.26
11 0.29
12 0.3
13 0.31
14 0.33
15 0.34
16 0.35
17 0.34
18 0.33
19 0.32
20 0.32
21 0.29
22 0.25
23 0.25
24 0.21
25 0.19
26 0.15
27 0.11
28 0.09
29 0.12
30 0.12
31 0.11
32 0.1
33 0.1
34 0.1
35 0.09
36 0.09
37 0.06
38 0.08
39 0.12
40 0.13
41 0.14
42 0.14
43 0.15
44 0.2
45 0.21
46 0.21
47 0.19
48 0.18
49 0.18
50 0.19
51 0.18
52 0.13
53 0.15
54 0.13
55 0.15
56 0.17
57 0.17
58 0.2
59 0.24
60 0.28
61 0.34
62 0.41
63 0.44
64 0.47
65 0.53
66 0.53
67 0.52
68 0.51
69 0.46
70 0.4
71 0.39
72 0.36
73 0.3
74 0.27
75 0.26
76 0.24
77 0.22
78 0.22
79 0.25
80 0.32
81 0.35
82 0.44
83 0.54
84 0.62
85 0.69
86 0.79
87 0.8
88 0.83
89 0.89
90 0.91
91 0.9
92 0.91
93 0.92
94 0.91
95 0.86
96 0.84
97 0.85
98 0.8
99 0.79
100 0.69
101 0.64
102 0.55
103 0.48
104 0.39
105 0.29
106 0.23
107 0.15
108 0.14
109 0.1
110 0.1
111 0.11
112 0.11
113 0.12
114 0.14
115 0.16
116 0.15
117 0.13
118 0.15
119 0.15
120 0.18
121 0.16
122 0.13
123 0.11
124 0.13
125 0.15
126 0.12
127 0.11
128 0.09
129 0.09
130 0.09
131 0.09
132 0.08
133 0.06
134 0.07
135 0.07
136 0.08
137 0.08
138 0.07
139 0.08
140 0.1
141 0.1
142 0.09
143 0.09
144 0.12
145 0.13
146 0.14
147 0.15
148 0.14
149 0.16
150 0.17
151 0.16
152 0.13
153 0.12
154 0.17
155 0.2
156 0.22
157 0.21
158 0.2
159 0.21
160 0.21
161 0.23
162 0.19
163 0.17
164 0.17
165 0.18
166 0.18
167 0.17
168 0.17
169 0.15
170 0.13
171 0.12
172 0.09
173 0.09
174 0.09
175 0.1
176 0.11
177 0.13
178 0.13
179 0.14
180 0.15
181 0.14
182 0.14
183 0.13
184 0.14
185 0.18
186 0.2
187 0.2
188 0.19
189 0.21
190 0.23
191 0.23
192 0.27
193 0.25
194 0.27
195 0.31
196 0.35
197 0.4
198 0.42
199 0.44
200 0.43
201 0.41
202 0.38
203 0.34
204 0.29
205 0.22
206 0.2
207 0.17
208 0.14
209 0.13
210 0.11
211 0.1
212 0.1
213 0.09
214 0.1
215 0.1
216 0.12
217 0.13
218 0.16
219 0.17
220 0.17