Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7TJ44

Protein Details
Accession A0A4Y7TJ44    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
248-278EASPYPGTGRRGRPRTRRRVEGRPCWFPRLRBasic
NLS Segment(s)
PositionSequence
257-267RRGRPRTRRRV
Subcellular Location(s) mito 11, nucl 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MSRWIVQRTEALKPFNLIPPTADVHPITFNPTSAVPSAISSFPPPSMASPPFPTSIITGAPASEPLNVSSSELNRNTSPSNVNDPASLSPASLNPSDSLMTGISSPAPMAASSPQNHTTLNGTSITKGKGKASAEDENRVDWRAAVESSRECSVSDVDTAAVQAAMSMSKKVHEAVQRQQVSSVYHSQSGEAYELLASGSSSVADDSDEALDAELAALLHESEFELVEEGPSPLKEPIVRGEESQEEEASPYPGTGRRGRPRTRRRVEGRPCWFPRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.39
4 0.31
5 0.27
6 0.28
7 0.3
8 0.28
9 0.29
10 0.22
11 0.22
12 0.24
13 0.23
14 0.25
15 0.22
16 0.21
17 0.19
18 0.19
19 0.2
20 0.17
21 0.18
22 0.13
23 0.14
24 0.16
25 0.15
26 0.16
27 0.16
28 0.16
29 0.15
30 0.16
31 0.16
32 0.16
33 0.21
34 0.23
35 0.25
36 0.28
37 0.3
38 0.3
39 0.29
40 0.27
41 0.23
42 0.21
43 0.18
44 0.15
45 0.13
46 0.12
47 0.11
48 0.12
49 0.11
50 0.11
51 0.11
52 0.1
53 0.12
54 0.11
55 0.12
56 0.14
57 0.15
58 0.21
59 0.21
60 0.23
61 0.22
62 0.25
63 0.24
64 0.24
65 0.25
66 0.22
67 0.28
68 0.28
69 0.28
70 0.26
71 0.27
72 0.25
73 0.24
74 0.21
75 0.13
76 0.12
77 0.12
78 0.14
79 0.13
80 0.13
81 0.11
82 0.12
83 0.12
84 0.11
85 0.11
86 0.09
87 0.08
88 0.08
89 0.07
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.04
96 0.05
97 0.07
98 0.11
99 0.12
100 0.16
101 0.18
102 0.19
103 0.19
104 0.19
105 0.19
106 0.16
107 0.16
108 0.15
109 0.13
110 0.13
111 0.15
112 0.16
113 0.16
114 0.16
115 0.16
116 0.18
117 0.19
118 0.21
119 0.24
120 0.29
121 0.29
122 0.32
123 0.32
124 0.28
125 0.28
126 0.25
127 0.2
128 0.13
129 0.12
130 0.09
131 0.08
132 0.08
133 0.09
134 0.09
135 0.11
136 0.11
137 0.11
138 0.1
139 0.11
140 0.11
141 0.1
142 0.1
143 0.08
144 0.08
145 0.07
146 0.07
147 0.06
148 0.05
149 0.04
150 0.03
151 0.03
152 0.04
153 0.04
154 0.05
155 0.05
156 0.06
157 0.07
158 0.08
159 0.13
160 0.18
161 0.23
162 0.29
163 0.39
164 0.4
165 0.4
166 0.4
167 0.37
168 0.33
169 0.32
170 0.31
171 0.22
172 0.23
173 0.23
174 0.22
175 0.21
176 0.2
177 0.17
178 0.11
179 0.1
180 0.07
181 0.07
182 0.06
183 0.05
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.05
193 0.05
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.05
200 0.05
201 0.04
202 0.04
203 0.03
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.05
211 0.05
212 0.06
213 0.06
214 0.06
215 0.07
216 0.08
217 0.08
218 0.08
219 0.1
220 0.1
221 0.12
222 0.13
223 0.14
224 0.2
225 0.24
226 0.25
227 0.24
228 0.27
229 0.29
230 0.31
231 0.31
232 0.25
233 0.21
234 0.21
235 0.21
236 0.18
237 0.15
238 0.11
239 0.12
240 0.16
241 0.21
242 0.27
243 0.36
244 0.45
245 0.55
246 0.65
247 0.74
248 0.81
249 0.87
250 0.89
251 0.9
252 0.87
253 0.89
254 0.9
255 0.89
256 0.87
257 0.87
258 0.82