Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7U0K3

Protein Details
Accession A0A4Y7U0K3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-108TTYQRRNGGRRPIANKPRAKHydrophilic
NLS Segment(s)
PositionSequence
95-110NGGRRPIANKPRAKAH
Subcellular Location(s) plas 16, mito 6, vacu 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTGGLFSSSHTTGHSGFTGGVSNFVSAIFGIIASLVQSVLALFQAFIARFAIATHFLAMIADVFSGVVGFIAGNFLAIAVCIAGYFAWTTYQRRNGGRRPIANKPRAKAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.13
4 0.13
5 0.16
6 0.13
7 0.14
8 0.12
9 0.12
10 0.11
11 0.1
12 0.1
13 0.06
14 0.07
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.03
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.02
67 0.02
68 0.02
69 0.03
70 0.02
71 0.03
72 0.04
73 0.04
74 0.08
75 0.11
76 0.15
77 0.21
78 0.29
79 0.35
80 0.42
81 0.49
82 0.54
83 0.63
84 0.69
85 0.71
86 0.7
87 0.75
88 0.79
89 0.8
90 0.79