Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SJQ0

Protein Details
Accession A0A4Y7SJQ0    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
193-216STSTSEGAKQKHNKKRRDKYRKKVBasic
NLS Segment(s)
PositionSequence
121-152RERIEKRRRAEERARRDSVSSRGEGPSRKKGK
201-216KQKHNKKRRDKYRKKV
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSGYNLRSRDTASKAIQMGKSIHPSVSASARRKISLHPEEPEGSEGPSETEVFEEALPSAEFGLEGHPDQLESDRESEQFDESQLRRSLSEGNIPASSTPVKNLGINAMDMAQSQLTRSQRERIEKRRRAEERARRDSVSSRGEGPSRKKGKAIDPHEWGAIELSEEEIEQQQALYDSIVKSKKHVQMGDDSSTSTSEGAKQKHNKKRRDKYRKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.44
4 0.41
5 0.4
6 0.37
7 0.41
8 0.36
9 0.33
10 0.28
11 0.28
12 0.27
13 0.32
14 0.36
15 0.34
16 0.39
17 0.41
18 0.42
19 0.42
20 0.44
21 0.46
22 0.47
23 0.48
24 0.44
25 0.46
26 0.46
27 0.46
28 0.43
29 0.33
30 0.24
31 0.19
32 0.16
33 0.13
34 0.12
35 0.11
36 0.08
37 0.08
38 0.08
39 0.09
40 0.08
41 0.08
42 0.07
43 0.08
44 0.08
45 0.07
46 0.07
47 0.05
48 0.06
49 0.05
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.1
58 0.1
59 0.1
60 0.12
61 0.13
62 0.13
63 0.14
64 0.15
65 0.14
66 0.13
67 0.12
68 0.16
69 0.15
70 0.21
71 0.22
72 0.22
73 0.2
74 0.21
75 0.24
76 0.19
77 0.24
78 0.2
79 0.2
80 0.19
81 0.19
82 0.18
83 0.16
84 0.16
85 0.1
86 0.1
87 0.1
88 0.11
89 0.11
90 0.11
91 0.11
92 0.1
93 0.1
94 0.1
95 0.08
96 0.07
97 0.07
98 0.07
99 0.05
100 0.04
101 0.05
102 0.09
103 0.1
104 0.14
105 0.15
106 0.21
107 0.26
108 0.35
109 0.44
110 0.5
111 0.6
112 0.64
113 0.68
114 0.72
115 0.72
116 0.7
117 0.73
118 0.72
119 0.71
120 0.73
121 0.71
122 0.62
123 0.59
124 0.55
125 0.51
126 0.45
127 0.35
128 0.29
129 0.28
130 0.3
131 0.34
132 0.36
133 0.39
134 0.41
135 0.41
136 0.42
137 0.44
138 0.5
139 0.54
140 0.56
141 0.53
142 0.53
143 0.53
144 0.51
145 0.47
146 0.38
147 0.28
148 0.21
149 0.13
150 0.08
151 0.07
152 0.06
153 0.06
154 0.07
155 0.07
156 0.07
157 0.06
158 0.06
159 0.06
160 0.07
161 0.07
162 0.07
163 0.09
164 0.09
165 0.16
166 0.21
167 0.21
168 0.24
169 0.32
170 0.38
171 0.43
172 0.45
173 0.42
174 0.46
175 0.52
176 0.53
177 0.45
178 0.39
179 0.33
180 0.31
181 0.28
182 0.19
183 0.14
184 0.16
185 0.22
186 0.25
187 0.34
188 0.44
189 0.54
190 0.64
191 0.73
192 0.76
193 0.81
194 0.88
195 0.9
196 0.92