Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DQA2

Protein Details
Accession A5DQA2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
133-163IQARHIPPAKLRKQKKREWWRRKFSSGFKELHydrophilic
NLS Segment(s)
PositionSequence
130-156LKKIQARHIPPAKLRKQKKREWWRRKF
Subcellular Location(s) mito 13, mito_nucl 13, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pgu:PGUG_05453  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MLRFGYTAFRGPSALPRPPRMSIIQNRLLSTSRLCLNNNTPSTGDKSKSQAIADVDNLLNETSNFHANSFSNRSKDRMFDISVKHPRDVAKSIRVQGPVAGRSVDVQYGNFARSLSSMFSVVRSNKIRYLKKIQARHIPPAKLRKQKKREWWRRKFSSGFKELMAQVRDAKRRGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.44
4 0.48
5 0.49
6 0.52
7 0.48
8 0.51
9 0.52
10 0.55
11 0.57
12 0.55
13 0.53
14 0.52
15 0.49
16 0.41
17 0.33
18 0.29
19 0.24
20 0.25
21 0.26
22 0.28
23 0.33
24 0.4
25 0.39
26 0.37
27 0.34
28 0.32
29 0.38
30 0.37
31 0.33
32 0.27
33 0.3
34 0.32
35 0.33
36 0.31
37 0.29
38 0.27
39 0.27
40 0.24
41 0.23
42 0.18
43 0.16
44 0.16
45 0.12
46 0.1
47 0.08
48 0.08
49 0.07
50 0.1
51 0.1
52 0.1
53 0.12
54 0.12
55 0.17
56 0.22
57 0.24
58 0.25
59 0.26
60 0.29
61 0.29
62 0.3
63 0.29
64 0.26
65 0.25
66 0.25
67 0.28
68 0.34
69 0.4
70 0.4
71 0.37
72 0.35
73 0.34
74 0.33
75 0.33
76 0.28
77 0.27
78 0.28
79 0.31
80 0.32
81 0.32
82 0.28
83 0.27
84 0.26
85 0.21
86 0.18
87 0.16
88 0.12
89 0.13
90 0.13
91 0.12
92 0.09
93 0.08
94 0.1
95 0.1
96 0.11
97 0.1
98 0.09
99 0.08
100 0.08
101 0.09
102 0.08
103 0.08
104 0.09
105 0.09
106 0.1
107 0.14
108 0.15
109 0.21
110 0.24
111 0.25
112 0.31
113 0.4
114 0.44
115 0.46
116 0.55
117 0.56
118 0.61
119 0.67
120 0.69
121 0.7
122 0.7
123 0.73
124 0.71
125 0.68
126 0.67
127 0.69
128 0.71
129 0.71
130 0.76
131 0.77
132 0.79
133 0.83
134 0.87
135 0.88
136 0.9
137 0.91
138 0.92
139 0.92
140 0.91
141 0.91
142 0.88
143 0.86
144 0.85
145 0.79
146 0.7
147 0.6
148 0.56
149 0.5
150 0.5
151 0.41
152 0.33
153 0.35
154 0.41
155 0.46