Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SBK1

Protein Details
Accession A0A4Y7SBK1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-77ARSVWFRRSTRCRRVKWRHNLVLFPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6extr 6, cyto 5, plas 4, cyto_nucl 4, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MPTALLSSELHRHLVPSFLGWLVWTKYSFCLWKAAIRSDPIDPLVQGRRQLVARSVWFRRSTRCRRVKWRHNLVLFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.14
4 0.14
5 0.12
6 0.12
7 0.11
8 0.13
9 0.12
10 0.13
11 0.12
12 0.12
13 0.13
14 0.16
15 0.17
16 0.15
17 0.18
18 0.17
19 0.21
20 0.22
21 0.24
22 0.23
23 0.23
24 0.24
25 0.2
26 0.2
27 0.17
28 0.15
29 0.12
30 0.13
31 0.16
32 0.16
33 0.17
34 0.17
35 0.19
36 0.19
37 0.21
38 0.21
39 0.21
40 0.24
41 0.29
42 0.32
43 0.35
44 0.39
45 0.4
46 0.46
47 0.52
48 0.58
49 0.63
50 0.69
51 0.73
52 0.79
53 0.88
54 0.9
55 0.9
56 0.91
57 0.9