Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SUF5

Protein Details
Accession A0A4Y7SUF5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-39SYPFKPPPLPQPRKNPPGKKPHFPLHydrophilic
NLS Segment(s)
PositionSequence
26-34PRKNPPGKK
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MCGQVARFRPLLRFSYPFKPPPLPQPRKNPPGKKPHFPLPRSEDHCNLPTAEVAVTPRPFVTGLLHCNVRTSREVHRMLSQAVELYGVYAMLGHRAWARQGTEVPAQGLKPYQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.49
4 0.49
5 0.49
6 0.51
7 0.47
8 0.54
9 0.6
10 0.61
11 0.62
12 0.69
13 0.74
14 0.77
15 0.85
16 0.83
17 0.81
18 0.83
19 0.82
20 0.8
21 0.76
22 0.77
23 0.77
24 0.69
25 0.68
26 0.63
27 0.66
28 0.63
29 0.61
30 0.53
31 0.48
32 0.48
33 0.4
34 0.34
35 0.25
36 0.18
37 0.15
38 0.12
39 0.08
40 0.08
41 0.1
42 0.1
43 0.1
44 0.09
45 0.09
46 0.09
47 0.09
48 0.11
49 0.11
50 0.13
51 0.16
52 0.17
53 0.16
54 0.19
55 0.18
56 0.18
57 0.17
58 0.18
59 0.22
60 0.3
61 0.32
62 0.32
63 0.36
64 0.35
65 0.34
66 0.31
67 0.25
68 0.16
69 0.14
70 0.13
71 0.08
72 0.07
73 0.06
74 0.05
75 0.04
76 0.05
77 0.04
78 0.06
79 0.06
80 0.07
81 0.09
82 0.1
83 0.12
84 0.15
85 0.17
86 0.18
87 0.21
88 0.24
89 0.27
90 0.28
91 0.29
92 0.27
93 0.25
94 0.24