Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7S1I6

Protein Details
Accession A0A4Y7S1I6    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTIDRLQWARRRTKRIKFYTKIRRVCPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MTIDRLQWARRRTKRIKFYTKIRRVCPTVTLSTSYQKLQQSRLQKLGLPRKDHYTTREVCKRLCASG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.88
4 0.85
5 0.87
6 0.88
7 0.88
8 0.85
9 0.79
10 0.75
11 0.68
12 0.61
13 0.55
14 0.48
15 0.42
16 0.36
17 0.34
18 0.28
19 0.28
20 0.28
21 0.24
22 0.23
23 0.24
24 0.24
25 0.25
26 0.29
27 0.35
28 0.38
29 0.42
30 0.39
31 0.38
32 0.45
33 0.51
34 0.53
35 0.5
36 0.47
37 0.5
38 0.55
39 0.56
40 0.52
41 0.5
42 0.49
43 0.53
44 0.6
45 0.55
46 0.51
47 0.56