Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SIH8

Protein Details
Accession A0A4Y7SIH8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
4-30GEEIFRKVRGKRWKRSRRPFAEHAHEVBasic
NLS Segment(s)
PositionSequence
9-22RKVRGKRWKRSRRP
Subcellular Location(s) cyto 13cyto_nucl 13, nucl 11
Family & Domain DBs
Amino Acid Sequences MDLGEEIFRKVRGKRWKRSRRPFAEHAHEVPDMCRRVQWAKCSERVRGDIRFPGGKWRCAGERWSWIQAIVGVVQRVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.67
3 0.76
4 0.83
5 0.92
6 0.94
7 0.93
8 0.91
9 0.88
10 0.86
11 0.84
12 0.77
13 0.67
14 0.6
15 0.5
16 0.42
17 0.34
18 0.31
19 0.24
20 0.19
21 0.17
22 0.16
23 0.22
24 0.24
25 0.3
26 0.31
27 0.34
28 0.42
29 0.44
30 0.45
31 0.43
32 0.44
33 0.42
34 0.38
35 0.37
36 0.33
37 0.34
38 0.33
39 0.29
40 0.36
41 0.35
42 0.35
43 0.33
44 0.33
45 0.32
46 0.32
47 0.36
48 0.3
49 0.35
50 0.37
51 0.4
52 0.36
53 0.34
54 0.32
55 0.3
56 0.25
57 0.19
58 0.17