Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DGW2

Protein Details
Accession A5DGW2    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-92AKEFRFCRSKCHRAFKQRRNPRKLRWTKAFRKAAGHydrophilic
212-232AEAVKQKVVLKNKKKAKRAVAHydrophilic
NLS Segment(s)
PositionSequence
72-91FKQRRNPRKLRWTKAFRKAA
222-230KNKKKAKRA
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Gene Ontology GO:0042254  P:ribosome biogenesis  
KEGG pgu:PGUG_02513  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MQAGRRARAHQYTRHHQWEHFSRDEIKVCGDSMRVYTCHFCSSPVYPLHGIMFVRNDAKEFRFCRSKCHRAFKQRRNPRKLRWTKAFRKAAGKELVVDSTLTFASRRNVPVRYNRDLVATTLKAMARVEEIRQKRERAFYKNRMRGNKDKQLANDKKLVEANPELLRMREVELRRKAERAEAKAAEASDMEMDSEMESESEAESEAESESEAEAVKQKVVLKNKKKAKRAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.73
3 0.65
4 0.68
5 0.69
6 0.67
7 0.6
8 0.54
9 0.49
10 0.51
11 0.53
12 0.44
13 0.37
14 0.31
15 0.28
16 0.26
17 0.22
18 0.18
19 0.17
20 0.19
21 0.17
22 0.19
23 0.22
24 0.22
25 0.25
26 0.24
27 0.23
28 0.24
29 0.26
30 0.3
31 0.28
32 0.31
33 0.27
34 0.28
35 0.27
36 0.26
37 0.23
38 0.18
39 0.18
40 0.16
41 0.18
42 0.17
43 0.17
44 0.17
45 0.2
46 0.25
47 0.25
48 0.29
49 0.36
50 0.36
51 0.45
52 0.52
53 0.6
54 0.61
55 0.7
56 0.73
57 0.75
58 0.86
59 0.87
60 0.89
61 0.89
62 0.91
63 0.91
64 0.9
65 0.89
66 0.89
67 0.89
68 0.87
69 0.86
70 0.86
71 0.85
72 0.87
73 0.85
74 0.77
75 0.75
76 0.68
77 0.65
78 0.59
79 0.49
80 0.4
81 0.33
82 0.3
83 0.21
84 0.19
85 0.12
86 0.09
87 0.08
88 0.07
89 0.06
90 0.07
91 0.09
92 0.11
93 0.15
94 0.17
95 0.2
96 0.24
97 0.33
98 0.38
99 0.41
100 0.4
101 0.37
102 0.35
103 0.33
104 0.3
105 0.25
106 0.18
107 0.14
108 0.15
109 0.14
110 0.13
111 0.13
112 0.12
113 0.1
114 0.11
115 0.12
116 0.18
117 0.2
118 0.26
119 0.3
120 0.32
121 0.32
122 0.4
123 0.43
124 0.45
125 0.52
126 0.57
127 0.64
128 0.69
129 0.73
130 0.73
131 0.74
132 0.75
133 0.74
134 0.73
135 0.68
136 0.64
137 0.62
138 0.65
139 0.64
140 0.57
141 0.54
142 0.45
143 0.42
144 0.42
145 0.38
146 0.31
147 0.26
148 0.27
149 0.22
150 0.25
151 0.22
152 0.2
153 0.2
154 0.16
155 0.17
156 0.19
157 0.21
158 0.28
159 0.36
160 0.41
161 0.42
162 0.44
163 0.42
164 0.45
165 0.49
166 0.45
167 0.46
168 0.41
169 0.41
170 0.41
171 0.4
172 0.32
173 0.24
174 0.19
175 0.11
176 0.1
177 0.09
178 0.07
179 0.07
180 0.06
181 0.07
182 0.06
183 0.05
184 0.05
185 0.06
186 0.06
187 0.05
188 0.06
189 0.06
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.07
199 0.07
200 0.11
201 0.12
202 0.13
203 0.16
204 0.21
205 0.28
206 0.38
207 0.48
208 0.54
209 0.63
210 0.73
211 0.79
212 0.83