Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TJI3

Protein Details
Accession A0A4Y7TJI3   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
130-150VTEMRYPHCHRPPPRSRPLMYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_nucl 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR002119  Histone_H2A  
IPR007125  Histone_H2A/H2B/H3  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
CDD cd00074  H2A  
Amino Acid Sequences MSLSPEVFGHVDTEANTDESGGNKQQNVRRCSRSAKADLQFPVGRVHRHLKKGRYAKRIGVGASVFLAAVLEYLPVELLELSGNIARASKKKCITPRYLLLAITNDTEFDLLLGQVTIAHGGMMPRVAIVTEMRYPHCHRPPPRSRPLMYKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.12
5 0.12
6 0.12
7 0.16
8 0.17
9 0.19
10 0.2
11 0.27
12 0.31
13 0.39
14 0.44
15 0.47
16 0.49
17 0.51
18 0.56
19 0.57
20 0.6
21 0.58
22 0.61
23 0.57
24 0.57
25 0.54
26 0.53
27 0.47
28 0.39
29 0.39
30 0.32
31 0.3
32 0.28
33 0.36
34 0.36
35 0.45
36 0.5
37 0.5
38 0.57
39 0.66
40 0.71
41 0.7
42 0.68
43 0.63
44 0.61
45 0.58
46 0.49
47 0.41
48 0.32
49 0.24
50 0.2
51 0.15
52 0.1
53 0.07
54 0.06
55 0.03
56 0.03
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.03
64 0.02
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.04
72 0.06
73 0.07
74 0.12
75 0.16
76 0.22
77 0.24
78 0.3
79 0.38
80 0.44
81 0.5
82 0.52
83 0.54
84 0.54
85 0.53
86 0.47
87 0.4
88 0.35
89 0.29
90 0.24
91 0.18
92 0.11
93 0.1
94 0.1
95 0.08
96 0.06
97 0.05
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.07
117 0.1
118 0.13
119 0.16
120 0.19
121 0.25
122 0.3
123 0.39
124 0.47
125 0.53
126 0.56
127 0.65
128 0.73
129 0.78
130 0.83
131 0.82
132 0.78
133 0.78