Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SAB2

Protein Details
Accession A0A4Y7SAB2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
238-263ASPPYAKLKKSPRIRRTPPSKPTIPPHydrophilic
NLS Segment(s)
PositionSequence
245-255LKKSPRIRRTP
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MHTFYGLANTRSLQRSFLHPSITQLLWAAFSLIQTRLAFPDPIVSPSSHAPQPRCAFRQRATDGILSAQDDKQTHVIKEKSNPSSPTLPLRAFWHIHSPLPPMATRRPWSVLKPKTKESVPSVPPYRQSLLVVATDNNRSTQTTYSILFLWTLSACRELLVPHPPPIQLQPRFKGALTSARLWPRTHSRVLCSFCPPPTPPFPSIQFPPTPGRQDSSTESIPSSNAQTHPLSSSSLSASPPYAKLKKSPRIRRTPPSKPTIPPSAAFDAASSQPSFSCYQFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.39
4 0.4
5 0.4
6 0.35
7 0.39
8 0.41
9 0.39
10 0.33
11 0.25
12 0.23
13 0.18
14 0.18
15 0.15
16 0.09
17 0.1
18 0.12
19 0.12
20 0.16
21 0.15
22 0.16
23 0.17
24 0.19
25 0.19
26 0.16
27 0.22
28 0.19
29 0.2
30 0.21
31 0.19
32 0.19
33 0.22
34 0.26
35 0.24
36 0.28
37 0.28
38 0.35
39 0.41
40 0.46
41 0.48
42 0.5
43 0.53
44 0.53
45 0.61
46 0.55
47 0.53
48 0.49
49 0.46
50 0.4
51 0.35
52 0.31
53 0.22
54 0.21
55 0.17
56 0.17
57 0.16
58 0.17
59 0.22
60 0.23
61 0.23
62 0.28
63 0.31
64 0.32
65 0.39
66 0.46
67 0.46
68 0.48
69 0.49
70 0.46
71 0.47
72 0.45
73 0.44
74 0.4
75 0.35
76 0.31
77 0.32
78 0.32
79 0.29
80 0.28
81 0.3
82 0.27
83 0.28
84 0.28
85 0.28
86 0.24
87 0.25
88 0.25
89 0.2
90 0.24
91 0.28
92 0.29
93 0.29
94 0.32
95 0.33
96 0.38
97 0.44
98 0.48
99 0.52
100 0.54
101 0.55
102 0.55
103 0.54
104 0.52
105 0.49
106 0.49
107 0.42
108 0.44
109 0.44
110 0.41
111 0.42
112 0.41
113 0.36
114 0.28
115 0.25
116 0.19
117 0.18
118 0.17
119 0.15
120 0.12
121 0.13
122 0.13
123 0.13
124 0.12
125 0.12
126 0.11
127 0.12
128 0.12
129 0.12
130 0.13
131 0.13
132 0.13
133 0.13
134 0.12
135 0.11
136 0.1
137 0.08
138 0.07
139 0.07
140 0.06
141 0.07
142 0.06
143 0.06
144 0.07
145 0.07
146 0.09
147 0.15
148 0.16
149 0.18
150 0.19
151 0.19
152 0.2
153 0.25
154 0.31
155 0.32
156 0.36
157 0.36
158 0.38
159 0.39
160 0.38
161 0.35
162 0.28
163 0.29
164 0.27
165 0.27
166 0.28
167 0.32
168 0.34
169 0.33
170 0.35
171 0.35
172 0.37
173 0.4
174 0.37
175 0.37
176 0.43
177 0.47
178 0.45
179 0.42
180 0.4
181 0.35
182 0.38
183 0.35
184 0.33
185 0.35
186 0.38
187 0.35
188 0.36
189 0.39
190 0.39
191 0.4
192 0.39
193 0.34
194 0.32
195 0.35
196 0.35
197 0.37
198 0.33
199 0.33
200 0.3
201 0.33
202 0.34
203 0.35
204 0.32
205 0.28
206 0.28
207 0.25
208 0.24
209 0.22
210 0.19
211 0.17
212 0.16
213 0.19
214 0.19
215 0.2
216 0.21
217 0.21
218 0.2
219 0.17
220 0.18
221 0.16
222 0.17
223 0.17
224 0.16
225 0.17
226 0.17
227 0.2
228 0.27
229 0.3
230 0.3
231 0.38
232 0.47
233 0.55
234 0.63
235 0.71
236 0.73
237 0.79
238 0.86
239 0.89
240 0.89
241 0.9
242 0.88
243 0.86
244 0.82
245 0.77
246 0.75
247 0.73
248 0.67
249 0.58
250 0.55
251 0.51
252 0.46
253 0.4
254 0.33
255 0.27
256 0.25
257 0.26
258 0.2
259 0.16
260 0.15
261 0.18
262 0.2
263 0.17