Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SDD5

Protein Details
Accession A0A4Y7SDD5    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTIDRLQWARRRTKRIKFYTKIRRVCPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MTIDRLQWARRRTKRIKFYTKIRRVCPAVTLSTSYQKLQQSRLQKLGLPRKDHYTTREVCKRLCASG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.88
4 0.85
5 0.87
6 0.88
7 0.88
8 0.85
9 0.77
10 0.74
11 0.66
12 0.59
13 0.52
14 0.44
15 0.36
16 0.3
17 0.29
18 0.23
19 0.25
20 0.25
21 0.21
22 0.23
23 0.24
24 0.25
25 0.26
26 0.3
27 0.34
28 0.38
29 0.42
30 0.39
31 0.38
32 0.45
33 0.51
34 0.53
35 0.5
36 0.47
37 0.5
38 0.55
39 0.56
40 0.52
41 0.5
42 0.49
43 0.53
44 0.6
45 0.55
46 0.51
47 0.56