Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TZK1

Protein Details
Accession A0A4Y7TZK1   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
166-189VYVIRTRYVRRRQRLRRGWTSSKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, mito_nucl 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035521  Fus1_SH3  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00018  SH3_1  
PROSITE View protein in PROSITE  
PS50002  SH3  
CDD cd11854  SH3_Fus1p  
Amino Acid Sequences MHRALQRRLPSADVNGRELHRRLAQANGGGYDSDSGMNLLPGDPITITITRVVQPATTTTVLSYASSQSVPATLPNGSPPLPRTTTWTTTSYAQASSMTSSSLGQSTTASLPRTSTVSIATGDLESGDSNQGLEPVSGSSAPRKVPSGVLIGVILACILVAFGVAVYVIRTRYVRRRQRLRRGWTSSKVSHLSVALEPKVPFSSSPPHAQQVPMLVKPRSERSPLTLDMTETMPLAPPNSYGNESQSPVSATLTSSQSPVYGPPATKALGQPITTVVSTFITTLPDELAITVGESIRVLAEYDDGWALCLNTRGEQGMIPMECLDGRFSIVAESISGNRGAGGNLRRVSSLQPGSVGSLGRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.44
4 0.47
5 0.44
6 0.42
7 0.38
8 0.38
9 0.37
10 0.38
11 0.4
12 0.38
13 0.38
14 0.34
15 0.3
16 0.26
17 0.24
18 0.19
19 0.15
20 0.11
21 0.09
22 0.09
23 0.08
24 0.08
25 0.08
26 0.08
27 0.07
28 0.07
29 0.08
30 0.07
31 0.08
32 0.11
33 0.11
34 0.12
35 0.13
36 0.15
37 0.16
38 0.17
39 0.17
40 0.14
41 0.15
42 0.16
43 0.19
44 0.18
45 0.16
46 0.15
47 0.16
48 0.16
49 0.15
50 0.15
51 0.11
52 0.12
53 0.12
54 0.12
55 0.11
56 0.11
57 0.11
58 0.1
59 0.11
60 0.1
61 0.11
62 0.12
63 0.15
64 0.15
65 0.17
66 0.19
67 0.23
68 0.25
69 0.25
70 0.3
71 0.34
72 0.38
73 0.39
74 0.39
75 0.35
76 0.35
77 0.37
78 0.31
79 0.25
80 0.21
81 0.17
82 0.16
83 0.15
84 0.13
85 0.1
86 0.09
87 0.09
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.1
94 0.11
95 0.14
96 0.14
97 0.14
98 0.14
99 0.15
100 0.17
101 0.15
102 0.13
103 0.12
104 0.12
105 0.12
106 0.12
107 0.11
108 0.09
109 0.09
110 0.08
111 0.07
112 0.06
113 0.06
114 0.06
115 0.05
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.05
123 0.06
124 0.06
125 0.07
126 0.09
127 0.12
128 0.13
129 0.14
130 0.15
131 0.15
132 0.16
133 0.17
134 0.17
135 0.15
136 0.14
137 0.13
138 0.11
139 0.1
140 0.09
141 0.06
142 0.03
143 0.02
144 0.02
145 0.02
146 0.01
147 0.01
148 0.01
149 0.01
150 0.01
151 0.02
152 0.02
153 0.02
154 0.03
155 0.04
156 0.05
157 0.06
158 0.09
159 0.19
160 0.29
161 0.38
162 0.47
163 0.58
164 0.67
165 0.78
166 0.85
167 0.84
168 0.83
169 0.83
170 0.8
171 0.76
172 0.72
173 0.63
174 0.58
175 0.52
176 0.42
177 0.34
178 0.28
179 0.23
180 0.18
181 0.19
182 0.15
183 0.15
184 0.15
185 0.15
186 0.15
187 0.13
188 0.12
189 0.12
190 0.18
191 0.18
192 0.23
193 0.24
194 0.26
195 0.26
196 0.26
197 0.24
198 0.25
199 0.25
200 0.23
201 0.25
202 0.23
203 0.25
204 0.27
205 0.31
206 0.28
207 0.28
208 0.26
209 0.27
210 0.32
211 0.32
212 0.33
213 0.29
214 0.25
215 0.23
216 0.23
217 0.18
218 0.13
219 0.12
220 0.08
221 0.08
222 0.08
223 0.07
224 0.07
225 0.09
226 0.11
227 0.13
228 0.13
229 0.17
230 0.19
231 0.2
232 0.2
233 0.19
234 0.18
235 0.16
236 0.16
237 0.12
238 0.1
239 0.12
240 0.14
241 0.14
242 0.13
243 0.13
244 0.12
245 0.12
246 0.13
247 0.14
248 0.14
249 0.14
250 0.15
251 0.17
252 0.17
253 0.19
254 0.19
255 0.21
256 0.22
257 0.22
258 0.21
259 0.21
260 0.22
261 0.2
262 0.19
263 0.14
264 0.11
265 0.11
266 0.11
267 0.1
268 0.1
269 0.1
270 0.1
271 0.09
272 0.09
273 0.08
274 0.08
275 0.08
276 0.06
277 0.06
278 0.06
279 0.06
280 0.06
281 0.06
282 0.06
283 0.05
284 0.06
285 0.06
286 0.05
287 0.06
288 0.06
289 0.08
290 0.08
291 0.08
292 0.08
293 0.08
294 0.09
295 0.09
296 0.13
297 0.12
298 0.13
299 0.15
300 0.15
301 0.15
302 0.15
303 0.16
304 0.18
305 0.17
306 0.16
307 0.15
308 0.15
309 0.15
310 0.15
311 0.15
312 0.09
313 0.1
314 0.1
315 0.09
316 0.1
317 0.1
318 0.1
319 0.09
320 0.11
321 0.11
322 0.13
323 0.13
324 0.12
325 0.11
326 0.12
327 0.12
328 0.16
329 0.19
330 0.25
331 0.27
332 0.29
333 0.29
334 0.3
335 0.32
336 0.35
337 0.35
338 0.28
339 0.28
340 0.28
341 0.29
342 0.3