Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7RIP2

Protein Details
Accession A0A4Y7RIP2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
22-45QFLRLPRKSGSRPLRDRRRPELTYHydrophilic
NLS Segment(s)
PositionSequence
29-39KSGSRPLRDRR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPSVTSMLLSWLVVDHSHSLIQFLRLPRKSGSRPLRDRRRPELTYHRHQPQRHTPLRTPPPPCPLVLPTNPSDPLLDPSAFDPSRPTSCEHTVSHIPLGPTPATRVSIPVPFDVPNATPPESNGLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.12
5 0.12
6 0.13
7 0.13
8 0.16
9 0.19
10 0.22
11 0.3
12 0.31
13 0.34
14 0.36
15 0.43
16 0.44
17 0.5
18 0.55
19 0.56
20 0.64
21 0.72
22 0.8
23 0.82
24 0.85
25 0.83
26 0.82
27 0.74
28 0.71
29 0.71
30 0.69
31 0.68
32 0.68
33 0.68
34 0.66
35 0.66
36 0.66
37 0.66
38 0.68
39 0.66
40 0.64
41 0.59
42 0.62
43 0.69
44 0.68
45 0.61
46 0.55
47 0.54
48 0.49
49 0.45
50 0.38
51 0.32
52 0.3
53 0.28
54 0.27
55 0.23
56 0.24
57 0.24
58 0.22
59 0.2
60 0.16
61 0.17
62 0.16
63 0.14
64 0.12
65 0.12
66 0.19
67 0.18
68 0.17
69 0.17
70 0.18
71 0.21
72 0.22
73 0.24
74 0.23
75 0.27
76 0.32
77 0.3
78 0.32
79 0.34
80 0.34
81 0.33
82 0.3
83 0.26
84 0.23
85 0.25
86 0.2
87 0.17
88 0.17
89 0.18
90 0.18
91 0.17
92 0.19
93 0.19
94 0.22
95 0.24
96 0.23
97 0.23
98 0.21
99 0.22
100 0.22
101 0.2
102 0.2
103 0.23
104 0.23
105 0.21
106 0.22