Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7TM54

Protein Details
Accession A0A4Y7TM54    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-72ILCCRCFGSRRRKMRSGKTRYRRYGSSRYHydrophilic
NLS Segment(s)
PositionSequence
53-65RRRKMRSGKTRYR
Subcellular Location(s) plas 12, extr 7, vacu 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSVVSAIGRGINAIISAIANVILTIVSAITYIIVAIFDVITDILCCRCFGSRRRKMRSGKTRYRRYGSSRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.02
15 0.03
16 0.03
17 0.03
18 0.03
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.04
32 0.05
33 0.05
34 0.06
35 0.1
36 0.15
37 0.24
38 0.35
39 0.44
40 0.54
41 0.63
42 0.71
43 0.77
44 0.83
45 0.86
46 0.85
47 0.87
48 0.87
49 0.89
50 0.9
51 0.87
52 0.84