Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DFH7

Protein Details
Accession A5DFH7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-117LPKPSRTSRQLQKRPRSRTLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13.333, cyto 9.5, mito_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pgu:PGUG_02028  -  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MSASNKILSEKPSELELQVAQAFVDLEQQSDLKAELRPLQFKSVREVEVNGGKKALAIFVPCPSLIAYRKVQTRLTRELEKKFPDRHVVFLAERRILPKPSRTSRQLQKRPRSRTLTAVHDKLLEDLVFPTEIVGKRVRYLVGGNKIHKVLLDSKDSTAVDYKLDSFAQLYTKLTGKQVVFEIPGEVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.22
4 0.19
5 0.17
6 0.16
7 0.13
8 0.12
9 0.12
10 0.09
11 0.14
12 0.11
13 0.11
14 0.12
15 0.12
16 0.12
17 0.12
18 0.13
19 0.09
20 0.1
21 0.12
22 0.18
23 0.23
24 0.27
25 0.28
26 0.36
27 0.38
28 0.38
29 0.42
30 0.4
31 0.38
32 0.35
33 0.34
34 0.3
35 0.34
36 0.36
37 0.29
38 0.25
39 0.22
40 0.22
41 0.2
42 0.17
43 0.1
44 0.09
45 0.1
46 0.11
47 0.12
48 0.12
49 0.12
50 0.12
51 0.15
52 0.15
53 0.18
54 0.19
55 0.23
56 0.27
57 0.29
58 0.34
59 0.36
60 0.4
61 0.43
62 0.45
63 0.49
64 0.5
65 0.52
66 0.53
67 0.52
68 0.52
69 0.48
70 0.46
71 0.47
72 0.43
73 0.4
74 0.36
75 0.34
76 0.29
77 0.3
78 0.29
79 0.21
80 0.21
81 0.2
82 0.2
83 0.2
84 0.21
85 0.24
86 0.3
87 0.35
88 0.41
89 0.43
90 0.49
91 0.55
92 0.64
93 0.67
94 0.69
95 0.74
96 0.77
97 0.81
98 0.82
99 0.8
100 0.71
101 0.69
102 0.64
103 0.63
104 0.6
105 0.54
106 0.46
107 0.4
108 0.37
109 0.3
110 0.26
111 0.16
112 0.1
113 0.09
114 0.09
115 0.08
116 0.07
117 0.07
118 0.1
119 0.11
120 0.13
121 0.16
122 0.15
123 0.16
124 0.18
125 0.18
126 0.15
127 0.19
128 0.24
129 0.31
130 0.36
131 0.37
132 0.39
133 0.39
134 0.38
135 0.35
136 0.3
137 0.28
138 0.26
139 0.3
140 0.28
141 0.29
142 0.33
143 0.33
144 0.31
145 0.27
146 0.23
147 0.18
148 0.18
149 0.18
150 0.16
151 0.16
152 0.15
153 0.12
154 0.13
155 0.15
156 0.15
157 0.16
158 0.16
159 0.19
160 0.2
161 0.22
162 0.26
163 0.24
164 0.26
165 0.26
166 0.27
167 0.26
168 0.24