Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75CN9

Protein Details
Accession Q75CN9   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-31AVKFSKSRKREYYYNPETKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, cyto_nucl 4.5, cyto 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046357  PPIase_dom_sf  
IPR000297  PPIase_PpiC  
IPR023058  PPIase_PpiC_CS  
IPR001202  WW_dom  
IPR036020  WW_dom_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0000993  F:RNA polymerase II complex binding  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:2000059  P:negative regulation of ubiquitin-dependent protein catabolic process  
GO:2000749  P:positive regulation of rDNA heterochromatin formation  
GO:0045899  P:positive regulation of RNA polymerase II transcription preinitiation complex assembly  
GO:0006369  P:termination of RNA polymerase II transcription  
KEGG ago:AGOS_ACL120W  -  
Pfam View protein in Pfam  
PF00639  Rotamase  
PF00397  WW  
PROSITE View protein in PROSITE  
PS01096  PPIC_PPIASE_1  
PS50198  PPIC_PPIASE_2  
PS01159  WW_DOMAIN_1  
PS50020  WW_DOMAIN_2  
CDD cd00201  WW  
Amino Acid Sequences MTAENGLPGPWAVKFSKSRKREYYYNPETKESQWEVPADTDSEQLARHLAEHPVQVRCLHLLIKHAGSRRPASHRNEHITLDKAAAVAELEQYAERYRQGERFEELARERSDCSSYKRGGDLGTFGRGEMQPSFEKVAFALPVGGVSDVVESDSGVHLIKRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.37
3 0.47
4 0.52
5 0.6
6 0.66
7 0.71
8 0.74
9 0.75
10 0.77
11 0.77
12 0.8
13 0.74
14 0.69
15 0.65
16 0.57
17 0.55
18 0.49
19 0.41
20 0.34
21 0.31
22 0.29
23 0.28
24 0.27
25 0.2
26 0.17
27 0.15
28 0.12
29 0.12
30 0.11
31 0.1
32 0.09
33 0.08
34 0.08
35 0.09
36 0.11
37 0.12
38 0.15
39 0.18
40 0.19
41 0.2
42 0.19
43 0.18
44 0.17
45 0.16
46 0.14
47 0.12
48 0.14
49 0.15
50 0.17
51 0.2
52 0.21
53 0.23
54 0.25
55 0.28
56 0.28
57 0.33
58 0.38
59 0.41
60 0.47
61 0.5
62 0.53
63 0.52
64 0.49
65 0.45
66 0.4
67 0.34
68 0.26
69 0.2
70 0.14
71 0.11
72 0.09
73 0.07
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.06
81 0.06
82 0.07
83 0.08
84 0.1
85 0.13
86 0.16
87 0.18
88 0.19
89 0.22
90 0.22
91 0.25
92 0.25
93 0.26
94 0.25
95 0.23
96 0.22
97 0.21
98 0.23
99 0.22
100 0.26
101 0.28
102 0.29
103 0.3
104 0.3
105 0.3
106 0.28
107 0.26
108 0.23
109 0.19
110 0.2
111 0.18
112 0.17
113 0.19
114 0.18
115 0.19
116 0.16
117 0.18
118 0.16
119 0.18
120 0.22
121 0.19
122 0.19
123 0.17
124 0.19
125 0.15
126 0.14
127 0.12
128 0.09
129 0.09
130 0.09
131 0.09
132 0.07
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.05
139 0.06
140 0.07
141 0.07
142 0.08
143 0.08