Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DQ43

Protein Details
Accession A5DQ43   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-54AKSQTSFYSRQKRRHKHELTDEELHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 8.5, cyto 8.5, mito 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013898  Atg43  
Gene Ontology GO:0016020  C:membrane  
GO:0140580  F:mitochondrion autophagosome adaptor activity  
GO:0000423  P:mitophagy  
KEGG pgu:PGUG_05394  -  
Amino Acid Sequences MDYKIPDLRFEETFVASLNAYAHPEQAAAQAKSQTSFYSRQKRRHKHELTDEELDLQPKPLPIPTSVVLYAIIKDQIVSPLLSGFLWTGILMVCGPILWQITNHGQRCGIWLANILHLNGGPPSFLKPKFTTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.14
4 0.14
5 0.12
6 0.11
7 0.12
8 0.12
9 0.12
10 0.11
11 0.11
12 0.11
13 0.16
14 0.21
15 0.19
16 0.21
17 0.23
18 0.23
19 0.24
20 0.24
21 0.19
22 0.17
23 0.23
24 0.3
25 0.39
26 0.46
27 0.55
28 0.65
29 0.74
30 0.79
31 0.83
32 0.82
33 0.8
34 0.83
35 0.81
36 0.75
37 0.69
38 0.6
39 0.51
40 0.44
41 0.36
42 0.25
43 0.18
44 0.13
45 0.1
46 0.1
47 0.09
48 0.1
49 0.1
50 0.13
51 0.13
52 0.14
53 0.14
54 0.14
55 0.13
56 0.12
57 0.11
58 0.08
59 0.08
60 0.05
61 0.06
62 0.05
63 0.06
64 0.07
65 0.07
66 0.06
67 0.06
68 0.07
69 0.06
70 0.06
71 0.05
72 0.04
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.05
84 0.05
85 0.05
86 0.06
87 0.1
88 0.18
89 0.26
90 0.28
91 0.28
92 0.28
93 0.28
94 0.31
95 0.31
96 0.23
97 0.16
98 0.2
99 0.2
100 0.25
101 0.26
102 0.22
103 0.2
104 0.19
105 0.19
106 0.15
107 0.14
108 0.09
109 0.08
110 0.14
111 0.2
112 0.22
113 0.28