Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DMX1

Protein Details
Accession A5DMX1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
243-264PEDSKKKDGLRIRKRSAKEKDSBasic
NLS Segment(s)
PositionSequence
247-262KKKDGLRIRKRSAKEK
Subcellular Location(s) cyto 20, cyto_nucl 15.5, nucl 7
Family & Domain DBs
KEGG pgu:PGUG_04622  -  
Amino Acid Sequences MSKYPQTQELPPLGALCLDYTDDIHRPPGDPLNPESFVFPLVHERVNNATVRNIVFSGVLDETLIDNFVDACNKLEAKGAIGVITSCGFLAQIQDRLASKINIPLASSSLLQIPSVLAFLPPNKKVAVLTFDEKELGKSHFDGVGLSEAMQKRIVVHGAKDGGELKNIIIEGGQYVIERFEAEMIELAKKAVSQDSSIGAFVFECTQMPPTSKAVQKALGLPVYDVVTMIDWFYSGLVCRTFPEDSKKKDGLRIRKRSAKEKDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.14
4 0.11
5 0.1
6 0.09
7 0.1
8 0.14
9 0.15
10 0.16
11 0.19
12 0.19
13 0.2
14 0.23
15 0.29
16 0.29
17 0.31
18 0.34
19 0.37
20 0.38
21 0.37
22 0.34
23 0.27
24 0.24
25 0.21
26 0.18
27 0.18
28 0.19
29 0.21
30 0.2
31 0.22
32 0.24
33 0.27
34 0.28
35 0.22
36 0.21
37 0.21
38 0.22
39 0.21
40 0.18
41 0.15
42 0.13
43 0.12
44 0.13
45 0.11
46 0.1
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.05
53 0.05
54 0.05
55 0.06
56 0.07
57 0.07
58 0.08
59 0.1
60 0.1
61 0.11
62 0.13
63 0.13
64 0.13
65 0.15
66 0.13
67 0.11
68 0.11
69 0.1
70 0.08
71 0.09
72 0.07
73 0.05
74 0.05
75 0.05
76 0.05
77 0.08
78 0.09
79 0.11
80 0.11
81 0.13
82 0.14
83 0.15
84 0.17
85 0.15
86 0.14
87 0.15
88 0.17
89 0.15
90 0.15
91 0.14
92 0.14
93 0.14
94 0.14
95 0.1
96 0.1
97 0.1
98 0.09
99 0.09
100 0.08
101 0.06
102 0.06
103 0.06
104 0.04
105 0.05
106 0.08
107 0.12
108 0.13
109 0.14
110 0.14
111 0.14
112 0.14
113 0.15
114 0.16
115 0.14
116 0.16
117 0.15
118 0.15
119 0.16
120 0.16
121 0.15
122 0.13
123 0.12
124 0.1
125 0.1
126 0.11
127 0.11
128 0.11
129 0.1
130 0.09
131 0.09
132 0.08
133 0.08
134 0.11
135 0.1
136 0.11
137 0.12
138 0.11
139 0.1
140 0.11
141 0.14
142 0.11
143 0.11
144 0.14
145 0.15
146 0.15
147 0.16
148 0.17
149 0.14
150 0.14
151 0.14
152 0.1
153 0.1
154 0.09
155 0.08
156 0.06
157 0.05
158 0.05
159 0.05
160 0.06
161 0.04
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.07
171 0.08
172 0.09
173 0.08
174 0.09
175 0.08
176 0.08
177 0.09
178 0.1
179 0.1
180 0.1
181 0.12
182 0.14
183 0.15
184 0.15
185 0.14
186 0.11
187 0.1
188 0.09
189 0.09
190 0.07
191 0.07
192 0.07
193 0.1
194 0.11
195 0.13
196 0.16
197 0.19
198 0.24
199 0.28
200 0.31
201 0.32
202 0.34
203 0.34
204 0.35
205 0.35
206 0.32
207 0.28
208 0.24
209 0.23
210 0.2
211 0.18
212 0.14
213 0.1
214 0.09
215 0.09
216 0.08
217 0.06
218 0.05
219 0.06
220 0.06
221 0.06
222 0.06
223 0.09
224 0.1
225 0.1
226 0.12
227 0.16
228 0.18
229 0.21
230 0.31
231 0.38
232 0.43
233 0.51
234 0.57
235 0.56
236 0.62
237 0.68
238 0.68
239 0.71
240 0.75
241 0.76
242 0.79
243 0.83
244 0.85