Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7S5M0

Protein Details
Accession A0A4Y7S5M0   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-38RGFRPVYPSKKARKDRAPRSAMHydrophilic
NLS Segment(s)
PositionSequence
26-31KKARKD
Subcellular Location(s) nucl 15.5, cyto_nucl 12.333, mito_nucl 9.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Amino Acid Sequences LIQEPYRNFADSIATARGFRPVYPSKKARKDRAPRSAMWVNEKISTNTWCELDMGDNPDITAIRLTGDFGQLAIFNVYNDCSNDDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.24
5 0.21
6 0.19
7 0.24
8 0.29
9 0.34
10 0.41
11 0.49
12 0.53
13 0.63
14 0.72
15 0.73
16 0.75
17 0.8
18 0.83
19 0.85
20 0.8
21 0.7
22 0.69
23 0.65
24 0.56
25 0.51
26 0.44
27 0.35
28 0.33
29 0.34
30 0.27
31 0.24
32 0.23
33 0.19
34 0.17
35 0.16
36 0.13
37 0.12
38 0.12
39 0.11
40 0.12
41 0.13
42 0.13
43 0.12
44 0.12
45 0.12
46 0.12
47 0.11
48 0.09
49 0.05
50 0.06
51 0.06
52 0.08
53 0.08
54 0.09
55 0.08
56 0.08
57 0.09
58 0.08
59 0.09
60 0.09
61 0.09
62 0.08
63 0.09
64 0.1
65 0.12
66 0.13