Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TL11

Protein Details
Accession A0A4Y7TL11   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKSVKRNNPKAERYKKLQQNHRLPNRHPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MKSVKRNNPKAERYKKLQQNHRLPNRHPNHVPLADKLNTTEQKIRKEIAIMKKLRHPHVVRLYEVIDDSLKDKIYMGASPFASHLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.82
4 0.82
5 0.81
6 0.82
7 0.84
8 0.86
9 0.84
10 0.79
11 0.8
12 0.75
13 0.73
14 0.64
15 0.57
16 0.54
17 0.51
18 0.49
19 0.41
20 0.4
21 0.33
22 0.32
23 0.29
24 0.28
25 0.25
26 0.25
27 0.3
28 0.28
29 0.32
30 0.33
31 0.32
32 0.26
33 0.28
34 0.32
35 0.34
36 0.39
37 0.37
38 0.38
39 0.43
40 0.48
41 0.48
42 0.51
43 0.44
44 0.45
45 0.53
46 0.54
47 0.49
48 0.46
49 0.43
50 0.35
51 0.33
52 0.25
53 0.15
54 0.12
55 0.12
56 0.12
57 0.11
58 0.11
59 0.11
60 0.12
61 0.14
62 0.16
63 0.17
64 0.2
65 0.2
66 0.21