Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SVZ9

Protein Details
Accession A0A4Y7SVZ9   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-28TKSHTLCRRCGNRAFHKQHKTCAQCHydrophilic
NLS Segment(s)
PositionSequence
45-48KRRK
Subcellular Location(s) mito 9, nucl 7, plas 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0016020  C:membrane  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences KRHTKSHTLCRRCGNRAFHKQHKTCAQCGFPSAKLRSYEWGQKAKRRKTTGTGRMRYLKEVSRRFKNGFRCVSSFFFLSYLPLLFLGGGAFRSLPRWCFRSDVIPPLCISTAYSIPLLAPPPALPSIDRSSINPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.78
4 0.81
5 0.81
6 0.83
7 0.8
8 0.8
9 0.8
10 0.74
11 0.69
12 0.66
13 0.6
14 0.5
15 0.5
16 0.46
17 0.4
18 0.43
19 0.4
20 0.38
21 0.36
22 0.36
23 0.37
24 0.37
25 0.41
26 0.4
27 0.47
28 0.46
29 0.52
30 0.61
31 0.64
32 0.69
33 0.66
34 0.64
35 0.63
36 0.7
37 0.72
38 0.73
39 0.68
40 0.64
41 0.66
42 0.63
43 0.57
44 0.49
45 0.44
46 0.42
47 0.47
48 0.48
49 0.47
50 0.51
51 0.51
52 0.54
53 0.57
54 0.56
55 0.52
56 0.49
57 0.45
58 0.44
59 0.43
60 0.39
61 0.31
62 0.23
63 0.19
64 0.15
65 0.14
66 0.1
67 0.08
68 0.07
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.07
80 0.08
81 0.11
82 0.14
83 0.17
84 0.18
85 0.21
86 0.23
87 0.28
88 0.31
89 0.37
90 0.36
91 0.35
92 0.34
93 0.33
94 0.32
95 0.24
96 0.21
97 0.15
98 0.14
99 0.14
100 0.14
101 0.12
102 0.12
103 0.14
104 0.14
105 0.11
106 0.11
107 0.1
108 0.13
109 0.14
110 0.15
111 0.14
112 0.18
113 0.23
114 0.27
115 0.28