Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7T5I6

Protein Details
Accession A0A4Y7T5I6    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
8-34VSSGGKAAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
11-28GGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKATVSSGGKAAKKKKWSKGKVKDKAQHAVTLDKTLYDRILKEVPTFKFISQSILIERLKVNGSLARVAIRHLEKEGQIRPIVHHSSQLIYTRVTSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.54
4 0.61
5 0.68
6 0.74
7 0.8
8 0.84
9 0.87
10 0.9
11 0.9
12 0.91
13 0.88
14 0.84
15 0.82
16 0.72
17 0.65
18 0.56
19 0.51
20 0.41
21 0.37
22 0.3
23 0.22
24 0.21
25 0.17
26 0.17
27 0.13
28 0.12
29 0.13
30 0.15
31 0.15
32 0.17
33 0.22
34 0.22
35 0.24
36 0.25
37 0.21
38 0.22
39 0.22
40 0.23
41 0.17
42 0.18
43 0.15
44 0.19
45 0.19
46 0.17
47 0.17
48 0.15
49 0.15
50 0.14
51 0.14
52 0.11
53 0.12
54 0.12
55 0.13
56 0.13
57 0.12
58 0.13
59 0.17
60 0.17
61 0.17
62 0.18
63 0.2
64 0.21
65 0.27
66 0.29
67 0.28
68 0.29
69 0.28
70 0.29
71 0.34
72 0.36
73 0.31
74 0.32
75 0.29
76 0.29
77 0.32
78 0.33
79 0.28
80 0.24
81 0.25