Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T228

Protein Details
Accession A0A4Y7T228   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
102-123LSEPATKRPKPNPKPVTRKATAHydrophilic
NLS Segment(s)
PositionSequence
109-113RPKPN
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MIHRECRGQLLASKSTPCSGTLAATQSTASTSTPLGPPTPSVSYSPQNSVPPGTPSMTSTTSSTASSTNHSPWTPVQPTPSLLGPYRLGKHPATDPPTPSPLSEPATKRPKPNPKPVTRKATAAAATASSSASANQSADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.32
4 0.27
5 0.24
6 0.2
7 0.19
8 0.19
9 0.21
10 0.19
11 0.18
12 0.17
13 0.14
14 0.15
15 0.13
16 0.11
17 0.09
18 0.09
19 0.1
20 0.12
21 0.13
22 0.13
23 0.13
24 0.14
25 0.17
26 0.18
27 0.18
28 0.19
29 0.22
30 0.26
31 0.27
32 0.29
33 0.28
34 0.27
35 0.27
36 0.26
37 0.23
38 0.21
39 0.2
40 0.18
41 0.15
42 0.15
43 0.18
44 0.18
45 0.18
46 0.16
47 0.16
48 0.16
49 0.16
50 0.15
51 0.13
52 0.12
53 0.13
54 0.14
55 0.14
56 0.15
57 0.15
58 0.15
59 0.15
60 0.21
61 0.21
62 0.2
63 0.21
64 0.2
65 0.22
66 0.22
67 0.22
68 0.17
69 0.15
70 0.17
71 0.17
72 0.19
73 0.2
74 0.2
75 0.23
76 0.21
77 0.23
78 0.25
79 0.3
80 0.32
81 0.32
82 0.34
83 0.34
84 0.37
85 0.36
86 0.32
87 0.28
88 0.27
89 0.27
90 0.3
91 0.3
92 0.36
93 0.45
94 0.48
95 0.52
96 0.58
97 0.66
98 0.68
99 0.76
100 0.77
101 0.78
102 0.85
103 0.88
104 0.87
105 0.79
106 0.74
107 0.65
108 0.61
109 0.52
110 0.44
111 0.35
112 0.27
113 0.24
114 0.21
115 0.18
116 0.12
117 0.11
118 0.1
119 0.1
120 0.11