Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SQ27

Protein Details
Accession A0A4Y7SQ27    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
141-170DCENDAPTGKRPRKRSRKSRKSVAANLSMRHydrophilic
NLS Segment(s)
PositionSequence
149-161GKRPRKRSRKSRK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046521  DUF6698  
Pfam View protein in Pfam  
PF20414  DUF6698  
Amino Acid Sequences LGSPFVEVTRGANDGRSHDVSQVKQAMASWVNGLRAPFSPSPPLTSDSRDGRGLQHDVCGRLLTPIDRDWDDPEVRAKFRAGAASEGYVISAFARALYSKFEGDLEQLEVGYLKSLLLVKTYQHIFTSPSSARGTDPQASDCENDAPTGKRPRKRSRKSRKSVAANLSMRGQVTPRSIAYAAIMVRPFPLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.3
4 0.28
5 0.31
6 0.37
7 0.33
8 0.39
9 0.4
10 0.33
11 0.3
12 0.29
13 0.28
14 0.24
15 0.24
16 0.2
17 0.17
18 0.18
19 0.19
20 0.19
21 0.16
22 0.16
23 0.21
24 0.19
25 0.2
26 0.25
27 0.25
28 0.28
29 0.28
30 0.3
31 0.27
32 0.29
33 0.32
34 0.3
35 0.33
36 0.31
37 0.3
38 0.29
39 0.31
40 0.3
41 0.25
42 0.26
43 0.25
44 0.24
45 0.24
46 0.22
47 0.17
48 0.15
49 0.16
50 0.12
51 0.12
52 0.12
53 0.15
54 0.15
55 0.16
56 0.17
57 0.21
58 0.2
59 0.19
60 0.23
61 0.22
62 0.22
63 0.22
64 0.2
65 0.17
66 0.18
67 0.2
68 0.15
69 0.14
70 0.14
71 0.14
72 0.14
73 0.12
74 0.11
75 0.08
76 0.07
77 0.05
78 0.04
79 0.04
80 0.03
81 0.04
82 0.04
83 0.05
84 0.07
85 0.08
86 0.07
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.08
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.05
99 0.04
100 0.03
101 0.04
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.12
108 0.14
109 0.14
110 0.13
111 0.14
112 0.15
113 0.15
114 0.21
115 0.17
116 0.2
117 0.2
118 0.2
119 0.21
120 0.22
121 0.25
122 0.23
123 0.24
124 0.22
125 0.22
126 0.23
127 0.23
128 0.22
129 0.19
130 0.15
131 0.15
132 0.15
133 0.16
134 0.22
135 0.31
136 0.38
137 0.42
138 0.52
139 0.63
140 0.72
141 0.81
142 0.85
143 0.86
144 0.9
145 0.93
146 0.94
147 0.93
148 0.92
149 0.9
150 0.86
151 0.85
152 0.76
153 0.68
154 0.59
155 0.5
156 0.41
157 0.32
158 0.26
159 0.21
160 0.22
161 0.23
162 0.21
163 0.24
164 0.23
165 0.23
166 0.23
167 0.22
168 0.2
169 0.21
170 0.2
171 0.16