Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DQ84

Protein Details
Accession A5DQ84    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
161-180NWSKDKIQAREDRRKRVQMWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
KEGG pgu:PGUG_05435  -  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MSRLIRFSTGVRAYSQVPYESVPRNRYNAKRSAFNFKPNPTHGLVHNPPASAPSLKKTPRPFLPAKDPRISVLADTYKVYSPEELQDMPLIVGYSQNRDYSVDGETALKIQKLRNENPGQWTISKLAKEFGISQKIVNVIAGTNIQRRKQLDGENLQLQANWSKDKIQAREDRRKRVQMWLRNEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.24
4 0.22
5 0.22
6 0.26
7 0.32
8 0.36
9 0.39
10 0.4
11 0.45
12 0.52
13 0.58
14 0.6
15 0.6
16 0.58
17 0.6
18 0.59
19 0.64
20 0.6
21 0.62
22 0.63
23 0.6
24 0.63
25 0.57
26 0.58
27 0.51
28 0.48
29 0.4
30 0.42
31 0.39
32 0.38
33 0.37
34 0.33
35 0.29
36 0.28
37 0.29
38 0.22
39 0.21
40 0.18
41 0.24
42 0.27
43 0.34
44 0.39
45 0.44
46 0.47
47 0.53
48 0.53
49 0.51
50 0.6
51 0.61
52 0.62
53 0.58
54 0.53
55 0.47
56 0.45
57 0.39
58 0.28
59 0.24
60 0.19
61 0.16
62 0.16
63 0.16
64 0.15
65 0.15
66 0.15
67 0.11
68 0.1
69 0.11
70 0.12
71 0.11
72 0.1
73 0.1
74 0.1
75 0.09
76 0.08
77 0.07
78 0.04
79 0.07
80 0.06
81 0.09
82 0.1
83 0.1
84 0.11
85 0.12
86 0.12
87 0.11
88 0.12
89 0.1
90 0.09
91 0.1
92 0.09
93 0.1
94 0.1
95 0.09
96 0.1
97 0.11
98 0.16
99 0.22
100 0.24
101 0.32
102 0.37
103 0.38
104 0.42
105 0.43
106 0.4
107 0.34
108 0.33
109 0.27
110 0.26
111 0.24
112 0.2
113 0.18
114 0.17
115 0.18
116 0.2
117 0.22
118 0.25
119 0.24
120 0.23
121 0.24
122 0.24
123 0.23
124 0.19
125 0.14
126 0.08
127 0.09
128 0.11
129 0.11
130 0.17
131 0.22
132 0.23
133 0.28
134 0.3
135 0.34
136 0.37
137 0.43
138 0.45
139 0.47
140 0.51
141 0.5
142 0.5
143 0.44
144 0.39
145 0.33
146 0.29
147 0.25
148 0.22
149 0.19
150 0.2
151 0.27
152 0.34
153 0.37
154 0.42
155 0.49
156 0.56
157 0.66
158 0.72
159 0.77
160 0.78
161 0.82
162 0.76
163 0.77
164 0.78
165 0.76