Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SLQ2

Protein Details
Accession A0A4Y7SLQ2    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
258-278RWETWRKREKTEVKTWTRRDLHydrophilic
NLS Segment(s)
PositionSequence
92-160KRKTERDKEEGGGEMKGMGGRTWKREKGQKLRVSGQGEEKERRGGREGNTKNGGARPVPKGAGRQHREE
199-202KGRR
216-232MRIKGTKQRRGGEAKTK
Subcellular Location(s) mito 13, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MSRRPREKLPATKSTLKITQDRPIPHETRQSPLLTKENTVPPPPKSNPLPFLVHRNAQATPWIGEPLNNFRLLSALLGYHQTRAVEERTEGKRKTERDKEEGGGEMKGMGGRTWKREKGQKLRVSGQGEEKERRGGREGNTKNGGARPVPKGAGRQHREEGEIGGRSDSGKLGGNGREQDGNKKIQSADKATGVRMGWKGRRGGEQESGEGAGANMRIKGTKQRRGGEAKTKDGGARPVLNGNRQLSAGPFPRMPNIRWETWRKREKTEVKTWTRRDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.68
3 0.62
4 0.61
5 0.57
6 0.57
7 0.55
8 0.56
9 0.54
10 0.56
11 0.55
12 0.52
13 0.57
14 0.51
15 0.49
16 0.5
17 0.48
18 0.42
19 0.45
20 0.47
21 0.39
22 0.39
23 0.4
24 0.44
25 0.44
26 0.47
27 0.46
28 0.43
29 0.5
30 0.51
31 0.52
32 0.51
33 0.54
34 0.52
35 0.51
36 0.53
37 0.46
38 0.52
39 0.5
40 0.46
41 0.42
42 0.4
43 0.36
44 0.31
45 0.32
46 0.25
47 0.21
48 0.19
49 0.19
50 0.16
51 0.17
52 0.2
53 0.23
54 0.23
55 0.23
56 0.22
57 0.19
58 0.2
59 0.19
60 0.16
61 0.09
62 0.07
63 0.07
64 0.11
65 0.11
66 0.11
67 0.12
68 0.12
69 0.12
70 0.14
71 0.15
72 0.13
73 0.14
74 0.21
75 0.26
76 0.34
77 0.34
78 0.37
79 0.42
80 0.45
81 0.54
82 0.56
83 0.56
84 0.54
85 0.58
86 0.54
87 0.49
88 0.47
89 0.38
90 0.29
91 0.22
92 0.16
93 0.11
94 0.1
95 0.09
96 0.06
97 0.11
98 0.13
99 0.19
100 0.26
101 0.29
102 0.33
103 0.4
104 0.5
105 0.54
106 0.63
107 0.62
108 0.61
109 0.62
110 0.64
111 0.6
112 0.52
113 0.48
114 0.44
115 0.42
116 0.38
117 0.34
118 0.34
119 0.32
120 0.31
121 0.28
122 0.26
123 0.26
124 0.34
125 0.35
126 0.35
127 0.37
128 0.36
129 0.33
130 0.31
131 0.29
132 0.2
133 0.22
134 0.19
135 0.18
136 0.19
137 0.19
138 0.23
139 0.29
140 0.37
141 0.37
142 0.39
143 0.4
144 0.4
145 0.4
146 0.35
147 0.3
148 0.23
149 0.21
150 0.17
151 0.14
152 0.13
153 0.12
154 0.11
155 0.1
156 0.08
157 0.08
158 0.08
159 0.12
160 0.14
161 0.17
162 0.17
163 0.18
164 0.22
165 0.21
166 0.27
167 0.27
168 0.3
169 0.27
170 0.28
171 0.28
172 0.28
173 0.31
174 0.3
175 0.29
176 0.29
177 0.3
178 0.28
179 0.31
180 0.26
181 0.26
182 0.25
183 0.28
184 0.27
185 0.31
186 0.34
187 0.33
188 0.39
189 0.39
190 0.4
191 0.42
192 0.39
193 0.36
194 0.34
195 0.31
196 0.25
197 0.21
198 0.16
199 0.1
200 0.09
201 0.08
202 0.08
203 0.08
204 0.09
205 0.1
206 0.21
207 0.29
208 0.37
209 0.45
210 0.49
211 0.56
212 0.63
213 0.69
214 0.7
215 0.67
216 0.64
217 0.58
218 0.55
219 0.5
220 0.45
221 0.42
222 0.37
223 0.33
224 0.29
225 0.34
226 0.36
227 0.39
228 0.41
229 0.39
230 0.35
231 0.32
232 0.31
233 0.26
234 0.29
235 0.29
236 0.27
237 0.28
238 0.28
239 0.35
240 0.39
241 0.37
242 0.41
243 0.42
244 0.45
245 0.5
246 0.59
247 0.61
248 0.68
249 0.76
250 0.71
251 0.72
252 0.77
253 0.79
254 0.78
255 0.79
256 0.79
257 0.79
258 0.85