Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SQK4

Protein Details
Accession A0A4Y7SQK4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
63-83IPKAPTRKKAPSKAQSKPRKDBasic
NLS Segment(s)
PositionSequence
65-82KAPTRKKAPSKAQSKPRK
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MRGSNVVASTPRVLIQVVEEGRKSLLNPPGKTKTVNWGSFTSSASSTGNVDNPPPNSAPAATIPKAPTRKKAPSKAQSKPRKDLWASEHPHPLGPLHGQTGSGTRVLPGPPQGRTGSGTHAPPQPPNTQGEHAERKIVKLRTSSGAVTGRSQPSRSPAVVLGPFKPPAVPQPPATDPTHAIETRREPPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.19
4 0.2
5 0.22
6 0.21
7 0.21
8 0.22
9 0.22
10 0.21
11 0.21
12 0.26
13 0.32
14 0.34
15 0.42
16 0.48
17 0.49
18 0.51
19 0.46
20 0.48
21 0.49
22 0.5
23 0.45
24 0.41
25 0.42
26 0.41
27 0.4
28 0.32
29 0.24
30 0.22
31 0.18
32 0.17
33 0.15
34 0.14
35 0.16
36 0.14
37 0.16
38 0.18
39 0.18
40 0.2
41 0.2
42 0.19
43 0.18
44 0.17
45 0.16
46 0.17
47 0.21
48 0.19
49 0.22
50 0.22
51 0.28
52 0.35
53 0.36
54 0.39
55 0.41
56 0.51
57 0.57
58 0.65
59 0.69
60 0.71
61 0.78
62 0.79
63 0.81
64 0.82
65 0.8
66 0.76
67 0.71
68 0.69
69 0.61
70 0.58
71 0.55
72 0.54
73 0.51
74 0.48
75 0.48
76 0.4
77 0.39
78 0.34
79 0.27
80 0.18
81 0.16
82 0.13
83 0.09
84 0.09
85 0.09
86 0.09
87 0.11
88 0.1
89 0.09
90 0.08
91 0.08
92 0.09
93 0.09
94 0.1
95 0.14
96 0.16
97 0.16
98 0.2
99 0.2
100 0.19
101 0.22
102 0.22
103 0.2
104 0.21
105 0.21
106 0.22
107 0.26
108 0.26
109 0.26
110 0.29
111 0.28
112 0.27
113 0.29
114 0.29
115 0.27
116 0.29
117 0.34
118 0.37
119 0.35
120 0.39
121 0.37
122 0.36
123 0.41
124 0.4
125 0.36
126 0.32
127 0.35
128 0.33
129 0.35
130 0.33
131 0.31
132 0.31
133 0.29
134 0.29
135 0.31
136 0.33
137 0.32
138 0.33
139 0.29
140 0.3
141 0.33
142 0.31
143 0.28
144 0.23
145 0.27
146 0.32
147 0.32
148 0.3
149 0.29
150 0.29
151 0.27
152 0.26
153 0.21
154 0.24
155 0.29
156 0.3
157 0.29
158 0.35
159 0.38
160 0.42
161 0.43
162 0.39
163 0.35
164 0.35
165 0.4
166 0.34
167 0.32
168 0.34
169 0.39
170 0.44