Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7TJV3

Protein Details
Accession A7TJV3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-77SEDEVSHKRVRKRWRRIVGESVSSHydrophilic
129-148SYKKYNKLTKYSRKKIQVPLHydrophilic
NLS Segment(s)
PositionSequence
64-66RKR
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007224  TIF_Rrn11  
Gene Ontology GO:0001164  F:RNA polymerase I core promoter sequence-specific DNA binding  
GO:0001181  F:RNA polymerase I general transcription initiation factor activity  
KEGG vpo:Kpol_1037p11  -  
Pfam View protein in Pfam  
PF04090  RNA_pol_I_TF  
Amino Acid Sequences MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNRYNKNGQGLPTPVSSENEMNASEDEVSHKRVRKRWRRIVGESVSSDEEEEEEEEDEQEQEGDEEKKYFSRYDKPEDSFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEITTTSTSSRTSSNYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYIDNSSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIEGRMIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.52
3 0.58
4 0.59
5 0.65
6 0.64
7 0.7
8 0.67
9 0.64
10 0.63
11 0.66
12 0.69
13 0.62
14 0.65
15 0.59
16 0.6
17 0.63
18 0.61
19 0.57
20 0.56
21 0.6
22 0.6
23 0.64
24 0.62
25 0.57
26 0.54
27 0.51
28 0.49
29 0.43
30 0.39
31 0.33
32 0.29
33 0.3
34 0.25
35 0.22
36 0.21
37 0.2
38 0.19
39 0.17
40 0.16
41 0.13
42 0.12
43 0.16
44 0.16
45 0.21
46 0.26
47 0.32
48 0.38
49 0.45
50 0.56
51 0.62
52 0.71
53 0.77
54 0.81
55 0.84
56 0.84
57 0.86
58 0.81
59 0.77
60 0.67
61 0.59
62 0.5
63 0.41
64 0.34
65 0.24
66 0.18
67 0.12
68 0.12
69 0.09
70 0.08
71 0.09
72 0.09
73 0.09
74 0.09
75 0.08
76 0.07
77 0.06
78 0.06
79 0.09
80 0.1
81 0.1
82 0.11
83 0.12
84 0.14
85 0.16
86 0.19
87 0.21
88 0.29
89 0.35
90 0.43
91 0.5
92 0.51
93 0.56
94 0.58
95 0.59
96 0.55
97 0.49
98 0.43
99 0.37
100 0.4
101 0.38
102 0.42
103 0.47
104 0.45
105 0.52
106 0.54
107 0.63
108 0.67
109 0.74
110 0.74
111 0.72
112 0.72
113 0.73
114 0.78
115 0.75
116 0.74
117 0.73
118 0.71
119 0.73
120 0.76
121 0.72
122 0.72
123 0.75
124 0.76
125 0.78
126 0.78
127 0.77
128 0.79
129 0.81
130 0.8
131 0.79
132 0.76
133 0.72
134 0.73
135 0.75
136 0.73
137 0.68
138 0.66
139 0.63
140 0.62
141 0.56
142 0.49
143 0.46
144 0.42
145 0.41
146 0.35
147 0.29
148 0.22
149 0.2
150 0.17
151 0.1
152 0.06
153 0.05
154 0.05
155 0.04
156 0.05
157 0.05
158 0.06
159 0.06
160 0.08
161 0.07
162 0.07
163 0.07
164 0.07
165 0.08
166 0.08
167 0.1
168 0.09
169 0.13
170 0.12
171 0.12
172 0.12
173 0.12
174 0.11
175 0.09
176 0.09
177 0.05
178 0.06
179 0.06
180 0.06
181 0.08
182 0.08
183 0.07
184 0.09
185 0.1
186 0.13
187 0.18
188 0.17
189 0.17
190 0.23
191 0.25
192 0.24
193 0.24
194 0.21
195 0.19
196 0.24
197 0.29
198 0.25
199 0.24
200 0.24
201 0.28
202 0.33
203 0.34
204 0.35
205 0.32
206 0.34
207 0.37
208 0.39
209 0.38
210 0.34
211 0.31
212 0.26
213 0.21
214 0.17
215 0.15
216 0.11
217 0.07
218 0.06
219 0.05
220 0.04
221 0.05
222 0.05
223 0.05
224 0.05
225 0.06
226 0.07
227 0.07
228 0.08
229 0.11
230 0.17
231 0.17
232 0.2
233 0.25
234 0.27
235 0.34
236 0.4
237 0.42
238 0.43
239 0.5
240 0.54
241 0.56
242 0.64
243 0.66
244 0.68
245 0.73
246 0.75
247 0.73
248 0.7
249 0.64
250 0.54
251 0.46
252 0.37
253 0.3
254 0.24
255 0.2
256 0.16
257 0.23
258 0.22
259 0.28
260 0.29
261 0.29
262 0.26
263 0.29
264 0.32
265 0.29
266 0.36
267 0.33
268 0.32
269 0.39
270 0.42
271 0.39
272 0.37
273 0.32
274 0.26
275 0.27
276 0.28
277 0.21
278 0.2
279 0.21
280 0.23
281 0.24
282 0.23
283 0.21
284 0.22
285 0.24
286 0.26
287 0.29
288 0.28
289 0.28
290 0.27
291 0.25
292 0.24
293 0.2
294 0.17
295 0.12
296 0.09
297 0.08
298 0.08
299 0.08
300 0.08
301 0.08
302 0.07
303 0.06
304 0.07
305 0.07
306 0.09
307 0.08
308 0.12
309 0.16
310 0.17
311 0.16
312 0.16
313 0.15
314 0.13
315 0.15
316 0.11
317 0.08
318 0.11
319 0.12
320 0.12
321 0.14
322 0.16
323 0.16
324 0.16
325 0.16
326 0.15
327 0.15
328 0.18
329 0.16
330 0.16
331 0.14
332 0.14
333 0.17
334 0.14
335 0.16
336 0.14
337 0.16
338 0.15
339 0.17
340 0.18
341 0.18
342 0.21
343 0.22
344 0.26
345 0.27
346 0.27
347 0.3
348 0.29
349 0.25
350 0.24
351 0.21
352 0.22
353 0.2
354 0.22
355 0.25
356 0.33
357 0.4
358 0.48
359 0.55
360 0.54
361 0.61
362 0.68
363 0.72
364 0.68
365 0.68
366 0.68
367 0.65
368 0.65
369 0.62
370 0.57
371 0.52
372 0.49
373 0.43
374 0.38
375 0.34
376 0.33
377 0.33
378 0.31
379 0.27
380 0.29
381 0.29