Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T922

Protein Details
Accession A0A4Y7T922   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-111RTGGRGRRRVNPYNKSNKTRKSKGREEDAVRBasic
NLS Segment(s)
PositionSequence
84-105GRGRRRVNPYNKSNKTRKSKGR
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MHIPPLLPVSMTMLALSGAALSLPLPSPQEGSSLDIYIASRANDSQTPMHPPPRSPSPPPMIQVFDPAGEIKEVIQTGPQRTGGRGRRRVNPYNKSNKTRKSKGREEDAVRQADKLALDLARLKLNSRTQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.05
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.05
11 0.06
12 0.07
13 0.08
14 0.1
15 0.1
16 0.13
17 0.13
18 0.16
19 0.16
20 0.15
21 0.15
22 0.13
23 0.13
24 0.12
25 0.12
26 0.09
27 0.08
28 0.08
29 0.11
30 0.11
31 0.13
32 0.14
33 0.15
34 0.22
35 0.24
36 0.3
37 0.3
38 0.3
39 0.32
40 0.39
41 0.42
42 0.38
43 0.42
44 0.41
45 0.42
46 0.43
47 0.4
48 0.33
49 0.29
50 0.28
51 0.22
52 0.16
53 0.14
54 0.12
55 0.1
56 0.08
57 0.08
58 0.05
59 0.06
60 0.06
61 0.06
62 0.09
63 0.11
64 0.12
65 0.14
66 0.18
67 0.17
68 0.18
69 0.27
70 0.33
71 0.4
72 0.48
73 0.51
74 0.57
75 0.65
76 0.73
77 0.74
78 0.75
79 0.75
80 0.77
81 0.81
82 0.81
83 0.81
84 0.81
85 0.81
86 0.82
87 0.82
88 0.8
89 0.82
90 0.81
91 0.82
92 0.81
93 0.78
94 0.78
95 0.75
96 0.71
97 0.61
98 0.54
99 0.45
100 0.38
101 0.31
102 0.22
103 0.18
104 0.12
105 0.14
106 0.17
107 0.19
108 0.22
109 0.22
110 0.23
111 0.28