Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7T6R6

Protein Details
Accession A0A4Y7T6R6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LSPPRVARKAPPKARPKVPRARNSFLHydrophilic
NLS Segment(s)
PositionSequence
20-37RVARKAPPKARPKVPRAR
Subcellular Location(s) mito 13.5, extr 9, cyto_mito 8.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MGTAALASWALVGTFLSPPRVARKAPPKARPKVPRARNSFLTVRPRIWLYRARRVQMFGNVENDEEDFFVTLRTRKFPRDGTLTPPRPSLGTSRDQFGRFLSPSTISSSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.12
5 0.14
6 0.21
7 0.25
8 0.25
9 0.31
10 0.41
11 0.5
12 0.58
13 0.66
14 0.69
15 0.73
16 0.82
17 0.83
18 0.82
19 0.81
20 0.82
21 0.82
22 0.8
23 0.79
24 0.72
25 0.69
26 0.63
27 0.59
28 0.58
29 0.51
30 0.44
31 0.39
32 0.37
33 0.32
34 0.31
35 0.32
36 0.3
37 0.38
38 0.41
39 0.42
40 0.41
41 0.42
42 0.41
43 0.39
44 0.37
45 0.28
46 0.27
47 0.25
48 0.24
49 0.22
50 0.2
51 0.14
52 0.1
53 0.08
54 0.05
55 0.05
56 0.05
57 0.07
58 0.09
59 0.11
60 0.16
61 0.19
62 0.22
63 0.27
64 0.31
65 0.35
66 0.41
67 0.41
68 0.45
69 0.53
70 0.55
71 0.52
72 0.49
73 0.44
74 0.37
75 0.36
76 0.34
77 0.28
78 0.3
79 0.3
80 0.34
81 0.38
82 0.38
83 0.37
84 0.34
85 0.35
86 0.28
87 0.28
88 0.26
89 0.24
90 0.24
91 0.29