Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7S0A9

Protein Details
Accession A0A4Y7S0A9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
9-31SVETTKKRRSGGRNKKGRGHVGFBasic
97-125VRSREGRRVRTPPPRVRWKDGKKVNPAVAHydrophilic
NLS Segment(s)
PositionSequence
14-27KKRRSGGRNKKGRG
98-119RSREGRRVRTPPPRVRWKDGKK
Subcellular Location(s) mito 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPDGVLQDSVETTKKRRSGGRNKKGRGHVGFVRCSNCSRCVPKDKAIKRFTVRNMVESAAVRDISEASVYADYVIPKLYIKIAYCVSCAIHSHVVRVRSREGRRVRTPPPRVRWKDGKKVNPAVAAAEDAKAQGRPVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.44
4 0.53
5 0.6
6 0.69
7 0.75
8 0.78
9 0.81
10 0.85
11 0.84
12 0.82
13 0.75
14 0.7
15 0.67
16 0.63
17 0.62
18 0.57
19 0.52
20 0.44
21 0.43
22 0.39
23 0.36
24 0.36
25 0.37
26 0.4
27 0.46
28 0.5
29 0.54
30 0.62
31 0.64
32 0.68
33 0.65
34 0.66
35 0.61
36 0.63
37 0.58
38 0.58
39 0.52
40 0.44
41 0.42
42 0.35
43 0.33
44 0.26
45 0.23
46 0.14
47 0.13
48 0.11
49 0.09
50 0.09
51 0.07
52 0.07
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.06
64 0.06
65 0.07
66 0.08
67 0.09
68 0.11
69 0.13
70 0.14
71 0.14
72 0.15
73 0.14
74 0.13
75 0.13
76 0.14
77 0.18
78 0.18
79 0.21
80 0.24
81 0.29
82 0.3
83 0.32
84 0.34
85 0.37
86 0.41
87 0.46
88 0.52
89 0.55
90 0.61
91 0.65
92 0.69
93 0.7
94 0.77
95 0.78
96 0.79
97 0.81
98 0.81
99 0.82
100 0.84
101 0.83
102 0.83
103 0.83
104 0.83
105 0.81
106 0.82
107 0.78
108 0.7
109 0.62
110 0.53
111 0.44
112 0.38
113 0.29
114 0.21
115 0.17
116 0.14
117 0.15
118 0.13