Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TSW5

Protein Details
Accession A0A4Y7TSW5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
285-310TNCSKDKGPAKKPADKKPNAPKNPAPHydrophilic
321-361APKPAPGKPAPKPKPAPKKPTPKPKPATKPGKPAPRPAGKPBasic
NLS Segment(s)
PositionSequence
291-365KGPAKKPADKKPNAPKNPAPGKGKPAPGKPAPKPAPGKPAPKPKPAPKKPTPKPKPATKPGKPAPRPAGKPTKKR
Subcellular Location(s) extr 17, E.R. 3, pero 2, golg 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MIFETGFLALAFLVAFPSLTTALPIESRQFEELDVVNLEARQGALSCHPVNIDQIKTLAAWKKIEQYAKDNYGEGGVNIVANPSEYPDRQLQACMKGGKIPVQFAEKPQCTTDRKNIDGKSIGTNSEIEFTTKTGISQTSSWTVTHSSTLTAGVKFGVTVGVPGIGASAETYMETTIHNERSTSFEGKNEHEETVKMKFSNKAGDQCKMELVTQMCTATAKGRAPVVASGFVWFNYEDKRAPKSGGDAHYKYSINIDSILSEDERTSFIEFQGPMNSKSSTTYNTNCSKDKGPAKKPADKKPNAPKNPAPGKGKPAPGKPAPKPAPGKPAPKPKPAPKKPTPKPKPATKPGKPAPRPAGKPTKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.04
4 0.06
5 0.07
6 0.07
7 0.09
8 0.09
9 0.1
10 0.12
11 0.14
12 0.16
13 0.18
14 0.21
15 0.21
16 0.21
17 0.2
18 0.22
19 0.21
20 0.19
21 0.17
22 0.15
23 0.14
24 0.14
25 0.13
26 0.1
27 0.1
28 0.08
29 0.07
30 0.08
31 0.1
32 0.16
33 0.17
34 0.17
35 0.18
36 0.18
37 0.23
38 0.27
39 0.25
40 0.2
41 0.2
42 0.2
43 0.2
44 0.25
45 0.25
46 0.24
47 0.26
48 0.27
49 0.34
50 0.39
51 0.44
52 0.42
53 0.42
54 0.46
55 0.49
56 0.48
57 0.4
58 0.35
59 0.32
60 0.28
61 0.22
62 0.16
63 0.1
64 0.09
65 0.08
66 0.08
67 0.06
68 0.06
69 0.06
70 0.08
71 0.11
72 0.11
73 0.15
74 0.19
75 0.21
76 0.21
77 0.26
78 0.26
79 0.27
80 0.32
81 0.3
82 0.27
83 0.29
84 0.29
85 0.31
86 0.29
87 0.26
88 0.24
89 0.29
90 0.29
91 0.3
92 0.39
93 0.34
94 0.34
95 0.35
96 0.39
97 0.38
98 0.42
99 0.47
100 0.44
101 0.46
102 0.52
103 0.51
104 0.49
105 0.47
106 0.43
107 0.4
108 0.34
109 0.31
110 0.25
111 0.24
112 0.2
113 0.19
114 0.17
115 0.12
116 0.11
117 0.11
118 0.12
119 0.11
120 0.11
121 0.1
122 0.1
123 0.11
124 0.11
125 0.13
126 0.15
127 0.16
128 0.16
129 0.15
130 0.16
131 0.15
132 0.16
133 0.14
134 0.11
135 0.1
136 0.12
137 0.12
138 0.11
139 0.1
140 0.09
141 0.08
142 0.08
143 0.07
144 0.06
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.06
163 0.09
164 0.11
165 0.11
166 0.11
167 0.11
168 0.15
169 0.19
170 0.2
171 0.17
172 0.19
173 0.21
174 0.23
175 0.27
176 0.25
177 0.22
178 0.19
179 0.19
180 0.18
181 0.19
182 0.19
183 0.15
184 0.15
185 0.18
186 0.19
187 0.25
188 0.26
189 0.3
190 0.31
191 0.35
192 0.35
193 0.32
194 0.32
195 0.26
196 0.24
197 0.19
198 0.17
199 0.15
200 0.14
201 0.14
202 0.12
203 0.12
204 0.12
205 0.1
206 0.13
207 0.12
208 0.12
209 0.13
210 0.13
211 0.14
212 0.15
213 0.14
214 0.12
215 0.12
216 0.11
217 0.11
218 0.11
219 0.11
220 0.09
221 0.09
222 0.1
223 0.12
224 0.14
225 0.17
226 0.2
227 0.21
228 0.22
229 0.22
230 0.24
231 0.29
232 0.32
233 0.37
234 0.35
235 0.36
236 0.4
237 0.39
238 0.35
239 0.31
240 0.26
241 0.19
242 0.19
243 0.16
244 0.11
245 0.12
246 0.13
247 0.1
248 0.1
249 0.09
250 0.09
251 0.09
252 0.1
253 0.12
254 0.11
255 0.11
256 0.15
257 0.16
258 0.16
259 0.22
260 0.23
261 0.23
262 0.25
263 0.25
264 0.21
265 0.23
266 0.24
267 0.21
268 0.25
269 0.27
270 0.32
271 0.39
272 0.43
273 0.42
274 0.44
275 0.43
276 0.46
277 0.52
278 0.54
279 0.55
280 0.61
281 0.67
282 0.72
283 0.78
284 0.8
285 0.81
286 0.77
287 0.79
288 0.8
289 0.83
290 0.81
291 0.81
292 0.76
293 0.76
294 0.79
295 0.77
296 0.73
297 0.67
298 0.68
299 0.67
300 0.69
301 0.66
302 0.63
303 0.64
304 0.65
305 0.7
306 0.67
307 0.71
308 0.67
309 0.69
310 0.69
311 0.67
312 0.69
313 0.67
314 0.7
315 0.68
316 0.75
317 0.73
318 0.76
319 0.8
320 0.8
321 0.84
322 0.85
323 0.87
324 0.85
325 0.9
326 0.9
327 0.92
328 0.91
329 0.9
330 0.89
331 0.9
332 0.91
333 0.9
334 0.91
335 0.88
336 0.9
337 0.88
338 0.9
339 0.84
340 0.84
341 0.83
342 0.82
343 0.79
344 0.78
345 0.8