Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TBR8

Protein Details
Accession A0A4Y7TBR8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
24-53PSPIIPLPSDRRRRRRNRSRRCRSVPAGPHBasic
NLS Segment(s)
PositionSequence
34-44RRRRRRNRSRR
Subcellular Location(s) plas 13, mito 6, E.R. 5, pero 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNRKRENLYKAGCLRIVCIVSFFPSPIIPLPSDRRRRRRNRSRRCRSVPAGPHIVVFLNVIQTLSLLLPPFSLVPPGKAVGGQFLRAKLVDVPVGSHIHLSIVFDVNSSPGSAYTAPKDGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.33
4 0.24
5 0.21
6 0.18
7 0.18
8 0.18
9 0.16
10 0.13
11 0.11
12 0.13
13 0.13
14 0.15
15 0.13
16 0.17
17 0.25
18 0.34
19 0.44
20 0.53
21 0.61
22 0.7
23 0.8
24 0.87
25 0.9
26 0.92
27 0.92
28 0.94
29 0.95
30 0.95
31 0.92
32 0.9
33 0.83
34 0.82
35 0.77
36 0.72
37 0.66
38 0.55
39 0.47
40 0.38
41 0.33
42 0.23
43 0.17
44 0.11
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.05
51 0.04
52 0.05
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.09
60 0.08
61 0.09
62 0.11
63 0.12
64 0.11
65 0.11
66 0.11
67 0.14
68 0.14
69 0.16
70 0.16
71 0.16
72 0.18
73 0.17
74 0.18
75 0.13
76 0.14
77 0.13
78 0.11
79 0.12
80 0.14
81 0.15
82 0.14
83 0.13
84 0.12
85 0.11
86 0.11
87 0.11
88 0.1
89 0.11
90 0.11
91 0.11
92 0.11
93 0.11
94 0.11
95 0.1
96 0.09
97 0.07
98 0.1
99 0.12
100 0.14
101 0.17
102 0.2