Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TCJ4

Protein Details
Accession A0A4Y7TCJ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-30RYPFRWEKEKQPRLFKKIPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 6, E.R. 6, cyto_nucl 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSFYIVVSCIRYPFRWEKEKQPRLFKKIPSDEAKSLICIMGGGALTPMFVAFGVAYHLLLFHCLSEQFLLRGGVLVEVPGVSRRLFLHRGYNGPQGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.5
4 0.58
5 0.66
6 0.75
7 0.75
8 0.77
9 0.78
10 0.78
11 0.82
12 0.77
13 0.76
14 0.74
15 0.74
16 0.69
17 0.66
18 0.59
19 0.55
20 0.49
21 0.39
22 0.32
23 0.24
24 0.17
25 0.11
26 0.09
27 0.06
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.02
36 0.02
37 0.03
38 0.02
39 0.02
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.04
49 0.05
50 0.05
51 0.06
52 0.07
53 0.08
54 0.07
55 0.09
56 0.09
57 0.08
58 0.09
59 0.08
60 0.08
61 0.07
62 0.07
63 0.05
64 0.05
65 0.05
66 0.07
67 0.08
68 0.07
69 0.09
70 0.11
71 0.17
72 0.21
73 0.23
74 0.31
75 0.34
76 0.4
77 0.43
78 0.49