Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SWN2

Protein Details
Accession A0A4Y7SWN2   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-36RLGGRRRPVPGRQRHRAPVRLBasic
63-95LISRTRRRHNPHTPSPHRPRTARPRCSPPRTTRBasic
NLS Segment(s)
PositionSequence
18-86GGRRRPVPGRQRHRAPVRLLSLLLPKRRLGRTSHRPRSSRRPRAVLISRTRRRHNPHTPSPHRPRTARP
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MAEAPLRGLDNGGTIRLGGRRRPVPGRQRHRAPVRLLSLLLPKRRLGRTSHRPRSSRRPRAVLISRTRRRHNPHTPSPHRPRTARPRCSPPRTTRTSLKDAPLNYIQPTLSVFPDPGHASPSWFAANGPPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.17
4 0.2
5 0.21
6 0.28
7 0.31
8 0.37
9 0.44
10 0.52
11 0.57
12 0.65
13 0.71
14 0.73
15 0.77
16 0.8
17 0.82
18 0.79
19 0.74
20 0.71
21 0.65
22 0.57
23 0.49
24 0.42
25 0.41
26 0.4
27 0.39
28 0.33
29 0.31
30 0.35
31 0.38
32 0.38
33 0.36
34 0.41
35 0.48
36 0.57
37 0.65
38 0.67
39 0.69
40 0.72
41 0.78
42 0.78
43 0.78
44 0.73
45 0.68
46 0.62
47 0.67
48 0.68
49 0.64
50 0.62
51 0.63
52 0.64
53 0.64
54 0.66
55 0.65
56 0.65
57 0.67
58 0.68
59 0.67
60 0.69
61 0.74
62 0.78
63 0.8
64 0.82
65 0.81
66 0.76
67 0.69
68 0.69
69 0.69
70 0.73
71 0.72
72 0.69
73 0.71
74 0.76
75 0.81
76 0.8
77 0.78
78 0.76
79 0.74
80 0.74
81 0.72
82 0.69
83 0.68
84 0.64
85 0.59
86 0.55
87 0.48
88 0.48
89 0.44
90 0.39
91 0.32
92 0.3
93 0.25
94 0.21
95 0.22
96 0.18
97 0.15
98 0.14
99 0.14
100 0.12
101 0.17
102 0.19
103 0.17
104 0.19
105 0.18
106 0.19
107 0.2
108 0.22
109 0.2
110 0.17
111 0.17
112 0.18