Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SGJ5

Protein Details
Accession A0A4Y7SGJ5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
133-164LTQHPNRRAGCWKKKKRQPQCWKSGSRQRGQGHydrophilic
NLS Segment(s)
PositionSequence
145-149KKKKR
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MAWKHTPQRHVKHFWASVVRWSEIGCRRGLQNMPNCHSQRSRLAADPQAGGHPQIDRYGSGPGNRAIQIVIHLYIVCQDRLDYAGAVKIGCRGDGMADGSRLPRLKAGIRVSRLIPESAASGTSSRGHEISGLTQHPNRRAGCWKKKKRQPQCWKSGSRQRGQGDQGAKRPGTRRSDSCMERAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.65
3 0.56
4 0.55
5 0.52
6 0.46
7 0.37
8 0.34
9 0.36
10 0.36
11 0.37
12 0.31
13 0.28
14 0.28
15 0.34
16 0.37
17 0.36
18 0.38
19 0.44
20 0.47
21 0.54
22 0.54
23 0.53
24 0.52
25 0.48
26 0.47
27 0.44
28 0.44
29 0.39
30 0.43
31 0.42
32 0.42
33 0.39
34 0.32
35 0.28
36 0.25
37 0.21
38 0.17
39 0.13
40 0.12
41 0.12
42 0.13
43 0.11
44 0.12
45 0.15
46 0.16
47 0.16
48 0.18
49 0.18
50 0.2
51 0.19
52 0.18
53 0.14
54 0.13
55 0.12
56 0.11
57 0.1
58 0.08
59 0.07
60 0.07
61 0.11
62 0.12
63 0.1
64 0.09
65 0.08
66 0.09
67 0.1
68 0.11
69 0.07
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.09
76 0.08
77 0.08
78 0.08
79 0.07
80 0.07
81 0.08
82 0.1
83 0.07
84 0.08
85 0.08
86 0.09
87 0.11
88 0.11
89 0.1
90 0.1
91 0.11
92 0.13
93 0.19
94 0.26
95 0.29
96 0.31
97 0.33
98 0.33
99 0.34
100 0.33
101 0.26
102 0.2
103 0.14
104 0.13
105 0.11
106 0.11
107 0.09
108 0.08
109 0.09
110 0.11
111 0.12
112 0.12
113 0.12
114 0.11
115 0.12
116 0.12
117 0.13
118 0.15
119 0.16
120 0.18
121 0.21
122 0.25
123 0.29
124 0.34
125 0.33
126 0.33
127 0.42
128 0.49
129 0.57
130 0.65
131 0.71
132 0.76
133 0.85
134 0.92
135 0.93
136 0.93
137 0.94
138 0.93
139 0.93
140 0.92
141 0.9
142 0.88
143 0.88
144 0.85
145 0.81
146 0.79
147 0.72
148 0.69
149 0.65
150 0.62
151 0.6
152 0.57
153 0.57
154 0.55
155 0.52
156 0.5
157 0.52
158 0.53
159 0.53
160 0.55
161 0.53
162 0.54
163 0.63
164 0.61